Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR169 IGR165 IGR164 IGR166 IGR170 IGR167 IGR171 IGR168 map, - HD0248 ftsL, - HD0240 HD0247 mraW, - HD0239 mraY, - HD0244 ftsW, - HD0246 murD, - HD0245 murF,murN, - HD0243 murE, - HD0242 ftsI,pbp3,prc, - HD0241 map, - HD0248 ftsL, - HD0240 HD0247 mraW, - HD0239 mraY, - HD0244 ftsW, - HD0246 murD, - HD0245 murF,murN, - HD0243 murE, - HD0242 ftsI,pbp3,prc, - HD0241 map, - HD0248 HD0247 mraW, - HD0239 mraY, - HD0244 ftsW, - HD0246 murD, - HD0245 murF,murN, - HD0243 murE, - HD0242 ftsI,pbp3,prc, - HD0241 ftsL, - HD0240
* Calculated from Protein Sequence

Gene ID: HD0243

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
murF  murN  

Definition:
UDP-MurNAc-pentapeptide synthetase

Gene Start:
183361

Gene Stop:
184764

Gene Length:
1404

Molecular Weight*:
50645

pI*:
6.60

Net Charge*:
-3.46

EC:
6.3.2.15  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Lysine biosynthesis
Peptideglycan biosynthesis

Secondary Evidence:
Parquet C, Flouret B, Mengin-Lecreulx D, van Heijenoort J.
Nucleotide sequence of the murF gene encoding the UDP-MurNAc-pentapeptide synthetase of Escherichia coli.
Nucleic Acids Res 1989 Jul 11;17(13):5379.
Medline: 89345095.

Dementin S, Bouhss A, Auger G, Parquet C, Mengin-Lecreulx D, Dideberg O, van Heijenoort J, Blanot D.
Evidence of a functional requirement for a carbamoylated lysine residue in MurD, MurE and MurF synthetases as established by chemical rescue experiments.
Eur J Biochem. 2001 Nov;268(22):5800-7.
PMID: 11722566

Comment:
For other "mur" genes, see HD1906 (murI), HD0242 (murE), HD0245 (murD), HD0253 (murA), HD0081 (murB), HD0823 (murC), HD0824 (murG).

Blast Summary:  PSI-Blast Search
Numerous hits to murF enzymes with gapped BLAST; e.g. residues 12-467 are 59% similar to murF (U32793)of Haemophilus influenzae, residues 12-467 are 51% similar to murF (U67891) of E. coli, residues 36-467 are 38% similar to UDP-MurNAc-pentapeptide synthetase (AL162758) of Neisseria meningitidis, residues 12-470 are 32% similar to murF (Z99106) of Bacillus subtilis.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0770
COG name: UDP-N-acetylmuramyl pentapeptide synthase
Functional Class:  M
The phylogenetic pattern of COG0770 is -mt--qvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 100-210 are 34% similar to a (LIGASE PROTEOME 6-DIAMINOPIMELATE--D-) protein domain (PD286651) which is seen in Q9RWA1_DEIRA.

Residues 313-456 are 53% similar to a (LIGASE CELL PROTEOME COMPLETE) protein domain (PD292385) which is seen in MURF_HAEIN.

Residues 145-223 are 82% similar to a (LIGASE SYNTHETASE CELL PEPTIDOGLYCAN SYNTHESIS ENZYME) protein domain (PD212530) which is seen in Q9CPB1_PASMU.

Residues 94-144 are 62% similar to a (LIGASE CELL PROTEOME SYNTHETASE) protein domain (PD122295) which is seen in MURF_HAEIN.

Residues 25-92 are 63% similar to a (LIGASE SYNTHETASE CELL ENZYME) protein domain (PD006359) which is seen in MURF_HAEIN.

Residues 255-312 are 67% similar to a (LIGASE SYNTHETASE CELL PEPTIDOGLYCAN) protein domain (PD039273) which is seen in MURF_HAEIN.



Paralogs:  Local Blast Search


HD0243 is paralogously related to HD0242 (5e-20), HD0245 (7e-08) and HD0823 (1e-05).


Pfam Summary:  Pfam Search
Residues 37 to 312 (E-value = 2.8e-64) place HD0243 in the Mur_ligase family which is described as Mur ligase family, catalytic domain (PF01225)
Residues 321 to 408 (E-value = 1.6e-07) place HD0243 in the Mur_ligase_C family which is described as Mur ligase family, glutamate ligase domain (PF02875)

PDB Hit:
pdb|1GG4|A Chain A, Crystal Structure Of Escherichia Coli Udpmu... 412 5e-116

Gene Protein Sequence:
MIKLTTKQVAQILNGQLIGDEYLVVETVNTDTRQAVENGLFFALKGNHFD
AHHYVDQAIAQGCIALVVEQRMLINAPQIIVADTRLALGELAKWLKAKLN
PKTIAITGSSGKTTVKEMAAKILQKLTACADEVLYTSGNLNNDLGVPLTL
LRLTEQHKFAVIELGANHLGEIAYTTSITQPDACVVNNVAAAHLEGFGSL
AGVAQAKGEIYRGLPPEGIAIINQASYSSAWQTEIGSRKVQSFALYPSAE
HKPVDFSAENVHLHLNGSTFMLHSPQGEIEINLPYLGEHNVSNVLAASAL
VMAVGADLAAIKAGLEQPVAVKGRLCPLPINRYCLLIDDTYNANVDSMKS
AVQVLKNYQAFRIFAVADMGELGKDSVACHQEVADFVREAELDLVVSFGK
ESAVISNQSTHHFTDKQAMHNFLMPIIMQKIAEKQPLVLLAKGSRSQKME
TLISSLCSSLHFSFKDK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCAAATTAACGACTAAACAAGTTGCACAAATTTTGAATGGCCAGTT
GATCGGAGATGAGTATTTAGTGGTGGAAACCGTGAATACTGACACTCGCC
AAGCGGTCGAAAATGGCTTATTTTTTGCTTTGAAAGGCAATCATTTTGAT
GCACATCATTATGTAGATCAAGCAATTGCTCAAGGCTGTATAGCTTTAGT
CGTGGAGCAACGGATGCTGATTAATGCACCGCAAATTATTGTTGCAGATA
CCCGTTTGGCATTAGGTGAGTTGGCAAAGTGGTTAAAAGCGAAATTGAAC
CCAAAAACGATTGCAATTACTGGTTCGTCTGGTAAAACAACCGTTAAAGA
AATGGCGGCAAAAATTTTGCAAAAGCTGACTGCTTGTGCTGATGAAGTGC
TTTATACTTCGGGTAATTTGAACAATGATTTAGGTGTACCTTTAACCTTA
TTGCGGTTAACTGAACAGCATAAATTTGCGGTTATTGAGTTAGGTGCTAA
TCATCTTGGTGAGATTGCTTATACTACCTCAATAACTCAACCGGATGCGT
GTGTAGTTAATAATGTTGCCGCCGCTCATTTGGAAGGGTTTGGATCCTTG
GCGGGTGTTGCACAAGCAAAAGGTGAAATTTATCGTGGTTTGCCCCCAGA
GGGGATCGCCATTATTAATCAAGCGAGTTATTCATCCGCTTGGCAAACTG
AGATTGGTTCACGTAAAGTGCAATCTTTTGCGCTTTATCCGTCAGCAGAG
CATAAACCGGTTGATTTTTCAGCGGAAAATGTACATCTACATTTAAATGG
TTCAACATTTATGCTCCATTCTCCACAAGGTGAGATTGAGATTAATTTGC
CTTATTTAGGTGAGCATAATGTTAGTAATGTATTAGCGGCTAGTGCATTA
GTTATGGCTGTTGGTGCCGATTTGGCCGCGATAAAGGCGGGCTTAGAACA
GCCTGTAGCGGTTAAGGGGCGGCTTTGCCCACTGCCAATAAATCGCTATT
GTTTATTGATTGATGATACTTATAATGCAAATGTTGATTCAATGAAATCT
GCTGTGCAAGTGTTAAAAAATTATCAGGCATTTCGTATCTTTGCCGTGGC
AGATATGGGCGAATTAGGTAAAGATAGCGTTGCTTGTCATCAAGAGGTTG
CTGATTTTGTGCGGGAAGCTGAGCTTGATTTGGTCGTCAGCTTTGGCAAA
GAGAGTGCGGTAATCAGTAACCAGTCAACGCATCATTTTACCGATAAACA
AGCAATGCATAATTTCTTAATGCCGATCATTATGCAAAAAATTGCAGAAA
AGCAACCGCTAGTGTTGTTAGCTAAAGGCTCTCGTAGTCAAAAAATGGAA
ACGTTGATTTCTAGTTTATGTTCTTCTCTTCATTTTTCTTTTAAGGACAA
ATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy