Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR169 IGR162 IGR165 IGR164 IGR166 IGR167 IGR168 IGR163 HD0238 ftsL, - HD0240 mraW, - HD0239 mraY, - HD0244 ftsW, - HD0246 murD, - HD0245 dcuB, - HD0237 murF,murN, - HD0243 murE, - HD0242 ftsI,pbp3,prc, - HD0241 HD0238 ftsL, - HD0240 mraW, - HD0239 mraY, - HD0244 ftsW, - HD0246 murD, - HD0245 dcuB, - HD0237 murF,murN, - HD0243 murE, - HD0242 ftsI,pbp3,prc, - HD0241 ftsL, - HD0240 mraW, - HD0239 mraY, - HD0244 ftsW, - HD0246 murD, - HD0245 dcuB, - HD0237 murF,murN, - HD0243 murE, - HD0242 ftsI,pbp3,prc, - HD0241 HD0238
* Calculated from Protein Sequence

Gene ID: HD0242

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
murE  

Definition:
UDP-N-acetylmuramyl-tripeptide synthetase

Gene Start:
181812

Gene Stop:
183317

Gene Length:
1506

Molecular Weight*:
55114

pI*:
6.30

Net Charge*:
-7.21

EC:
6.3.2.13  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Lysine biosynthesis
Peptideglycan biosynthesis

Secondary Evidence:
Tao JS, Ishiguro EE.
Nucleotide sequence of the murE gene of Escherichia coli.
Can J Microbiol 1989 Nov;35(11):1051-4.
Medline: 90124047.

Dementin S, Bouhss A, Auger G, Parquet C, Mengin-Lecreulx D, Dideberg O, van Heijenoort J, Blanot D.
Evidence of a functional requirement for a carbamoylated lysine residue in MurD, MurE and MurF synthetases as established by chemical rescue experiments.
Eur J Biochem. 2001 Nov;268(22):5800-7.
PMID: 11722566

Wijayarathna CD, Wachi M, Nagai K.
Isolation of ftsI and murE genes involved in peptidoglycan synthesis from Corynebacterium glutamicum.
Appl Microbiol Biotechnol. 2001 May;55(4):466-70.
PMID: 11398928

Comment:
For other "mur" genes, see HD1906 (murI), HD0243 (murF), HD0245 (murD), HD0253 (murA), HD0081 (murB), HD0823 (murC), HD0824 (murG).

Blast Summary:  PSI-Blast Search
Numerous hits to murE enzymes with gapped BLAST; e.g. residues 19-499 are 51% similar to murE (U32793) of Haemophilus influenzae, residues 21-499 are 48% similar to murE enzyme (X55034) of E. coli, residues 14-499 are 42% similar to probable murE (AF141867) of Vibrio cholerae, residues 27-499 are 39% similar to UDP-N
acetylmuramoylalanyl-D-glutamate (AE002397) of Neisseria meningitidis.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0769
COG name: UDP-N-acetylmuramyl tripeptide synthase
Functional Class:  M
The phylogenetic pattern of COG0769 is --T--qvCebRhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 391-435 are 57% similar to a (UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2) protein domain (PD410520) which is seen in Q9F1N5_SHEVI.

Residues 190-272 are 63% similar to a (LIGASE SYNTHETASE CELL PEPTIDOGLYCAN SYNTHESIS ENZYME) protein domain (PD212530) which is seen in MURE_PASMU.

Residues 145-188 are 75% similar to a (SYNTHETASE LIGASE) protein domain (PD378495) which is seen in MURE_PASMU.

Residues 21-65 are 60% similar to a (LIGASE SYNTHETASE CELL ENZYME) protein domain (PD006359) which is seen in MURE_ECOLI.

Residues 422-499 are 39% similar to a (SYNTHETASE MESO-) protein domain (PD392605) which is seen in MURE_THEMA.

Residues 344-475 are 62% similar to a (LIGASE SYNTHETASE CELL PEPTIDOGLYCAN SYNTHESIS) protein domain (PD001216) which is seen in MURE_PASMU.



Paralogs:  Local Blast Search


HD0242 is paralogously related to HD0243 (5e-20), HD0703 (1e-06), HD0245 (7e-05) and HD0823 (7e-04).


Pfam Summary:  Pfam Search
Residues 33 to 335 (E-value = 7e-64) place HD0242 in the Mur_ligase family which is described as Mur ligase family, catalytic domain (PF01225)
Residues 344 to 435 (E-value = 3.2e-30) place HD0242 in the Mur_ligase_C family which is described as Mur ligase family, glutamate ligase domain (PF02875)

PDB Hit:
pdb|1GG4|A Chain A, Crystal Structure Of Escherichia Coli Udpmu... 67 6e-012

Gene Protein Sequence:
MKRLLPFLTDLEAWVEQLIPLKQMTLDSRQVTEGDLFIALKGHQCDGRQF
IQNAIEQGAAIILAEAESDQDEIELDSQFARYNLDRRACKVITVPRLAER
LSAIADSFYASPSAKLKLIGITGTNGKTTTAQLLAQWHNLLGGHSAVMGT
IGNGLYGQEQEAINTTGSAIEVQQNLARFVEQGADFCAMEVSSHGLAQYR
VEALQYDLAIFTNLSRDHLDYHHSIAAYEAAKFRLFNALQTKAQVLNADD
QVAQNWLSMLPNAVLVSCDPNFTSEHQFVKATKVNFSLQGAYIEFESSWG
NGQFHSQLSGAFNVTNILLALAGLLTLGYDLAKLVATASQLRSVTGRMQK
VSAITDKNRPLVLVDYAHTPDALQKALQAARLHTKGKLFCVFGCGGDRDC
GKRPLMATIAEELADGVIVTNDNPRTEDQHKIVAEIMQGFAKPDNILVIY
DREQAIQHAIKHASSADLILIAGKGHENYQIIGTIKHHFSDQEIASKYLS
Q$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACGTTTATTGCCATTTTTAACGGACCTTGAGGCTTGGGTCGAACA
ATTAATTCCGCTTAAGCAGATGACTTTAGATTCACGCCAAGTGACAGAAG
GCGATCTTTTTATTGCTTTAAAAGGCCATCAGTGTGATGGGCGTCAGTTT
ATTCAAAATGCGATTGAACAAGGTGCGGCAATTATTTTGGCGGAAGCAGA
AAGTGATCAAGATGAAATTGAGTTAGATAGCCAATTTGCGCGTTATAATT
TAGATCGCCGAGCCTGTAAGGTCATTACTGTTCCACGATTAGCGGAAAGA
TTATCAGCGATTGCAGATAGTTTTTACGCTAGCCCATCAGCAAAATTGAA
GTTAATTGGCATTACCGGTACCAATGGTAAAACAACCACCGCTCAATTGT
TAGCGCAATGGCATAACTTATTAGGCGGGCATTCTGCCGTAATGGGAACC
ATTGGTAATGGTTTATATGGACAAGAACAAGAAGCGATCAATACCACCGG
TTCTGCTATTGAAGTACAACAAAATTTAGCCCGCTTTGTTGAACAGGGAG
CTGATTTCTGTGCAATGGAAGTGTCATCTCACGGTTTAGCACAATATCGA
GTAGAGGCATTGCAATATGATCTCGCTATATTTACTAATTTAAGTCGTGA
TCATCTTGATTATCACCACTCAATTGCCGCATATGAAGCGGCTAAATTCC
GTCTATTTAATGCTTTACAGACTAAAGCTCAGGTCTTAAATGCGGATGAT
CAAGTCGCGCAAAATTGGTTATCTATGTTGCCTAATGCTGTGCTAGTGAG
TTGTGATCCAAACTTTACCAGTGAACATCAATTTGTTAAGGCTACTAAGG
TTAATTTTAGCTTACAAGGTGCTTATATTGAGTTTGAATCAAGCTGGGGA
AATGGTCAATTTCATAGTCAATTGAGTGGAGCATTTAATGTTACCAATAT
TTTGTTGGCATTAGCTGGTTTATTAACTTTAGGCTATGATTTAGCTAAAT
TAGTCGCAACGGCTTCCCAATTACGCTCAGTAACGGGTCGAATGCAAAAG
GTTTCTGCTATAACAGATAAAAATCGACCGCTTGTATTAGTGGATTATGC
CCATACGCCTGATGCTTTGCAAAAAGCATTGCAGGCAGCGCGTTTACACA
CTAAAGGTAAATTGTTTTGTGTCTTTGGTTGTGGTGGTGATCGTGATTGT
GGTAAGCGTCCATTGATGGCGACTATTGCAGAAGAATTGGCGGATGGCGT
GATTGTGACCAACGATAATCCTCGCACAGAAGATCAACACAAGATTGTGG
CGGAGATTATGCAAGGCTTTGCAAAGCCTGATAATATCCTTGTCATTTAT
GATCGAGAACAAGCAATTCAACACGCGATTAAGCACGCTTCATCAGCAGA
TCTGATTTTGATTGCGGGTAAAGGTCACGAAAATTATCAAATTATAGGCA
CAATAAAACATCATTTTTCGGATCAAGAAATAGCGAGTAAGTATCTCTCA
CAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy