Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR162 IGR165 IGR164 IGR166 IGR159 IGR167 IGR161 IGR160 IGR163 HD0236 carA, - HD0235 carB, - HD0233 HD0238 ftsL, - HD0240 mraW, - HD0239 dcuB, - HD0237 murF,murN, - HD0243 murE, - HD0242 ftsI,pbp3,prc, - HD0241 HD0236 carA, - HD0235 carB, - HD0233 HD0238 ftsL, - HD0240 mraW, - HD0239 dcuB, - HD0237 murF,murN, - HD0243 murE, - HD0242 ftsI,pbp3,prc, - HD0241 HD0236 carA, - HD0235 carB, - HD0233 HD0238 ftsL, - HD0240 mraW, - HD0239 dcuB, - HD0237 murF,murN, - HD0243 murE, - HD0242 ftsI,pbp3,prc, - HD0241
* Calculated from Protein Sequence

Gene ID: HD0239

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
mraW  

Definition:
S-adenosyl-methyltransferase (involved in cell envelope biogenesis)

Gene Start:
178458

Gene Stop:
179411

Gene Length:
954

Molecular Weight*:
34995

pI*:
9.80

Net Charge*:
6.85

EC:
2.1.1.-  

Functional Class:
Cell envelope; Other  

Pathway: pathway table

Secondary Evidence:
Francis F, Ramirez-Arcos S, Salimnia H, Victor C, Dillon JR.
Organization and transcription of the division cell wall (dcw) cluster in Neisseria gonorrhoeae.
Gene. 2000 Jun 27;251(2):141-51.
PMID: 10876091

Carrion M, Gomez MJ, Merchante-Schubert R, Dongarra S, Ayala JA.
mraW, an essential gene at the dcw cluster of Escherichia coli codes for a cytoplasmic protein with methyltransferase activity.
Biochimie. 1999 Aug-Sep;81(8-9):879-88.
PMID: 10572301

Comment:


Blast Summary:  PSI-Blast Search
Significant hits to conserved hypothetical proteins with gapped BLAST; e.g. residues 3-316 are 73% similar to conserved hypothetical protein (U32793) of Haemophilus influenzae Rd, residues 9-316 are 65% similar to hypothetical protein (X52063) of E. coli, residues 10-316 are 54% similar to conserved hypothetical protein (AE002397) as seen in Neisseria meningitidis, residues 9-316 are 44% similar to unknown protein (U94707) as seen in Enterococcus faecalis.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0275
COG name: Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis
Functional Class: M
The phylogenetic pattern of COG0275 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002903 (Methyltransferase family) with a combined E-value of 4.2e-96.
    IPB002903A    32-47
    IPB002903B    99-133
    IPB002903C    156-170
    IPB002903D    206-223
    IPB002903E    241-257
    IPB002903F    287-316


ProDom Summary:  Protein Domain Search
Residues 11-316 are 75% similar to a (PROTEOME COMPLETE BU224 TRANSFERASE) protein domain (PD004685) which is seen in YABC_HAEIN.



Paralogs:  Local Blast Search
HD0239 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 317 (E-value = 1.5e-177) place HD0239 in the Methyltransf_5 family which is described as MraW methylase family (PF01795)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LKNSMNETDHKHITVLLHEAVDGLAIKPNGIYIDGTFGRGGHSRLILSRL
ATNGRLIAIDRDPCAIAEANTISDARFQIIHTAFSAIPEVCESLGLMGKI
DGILLDLGVSSPQLDDAERGFSFMRDGPLDMRMDTTKGLSAAEWLAQVSI
EDLAWVLKTFGEERFAKRIAQAVVSYNKTNSEKITRTLQLAKIIADAVPF
KDKHKHPATRSFQAIRIFINRELDELEKALTNALRVLAPEGRLSIISFHS
LEDRMVKQFMKKNSKGEVVPKGLPILEAELNKNIPLNIIGKAIMPSEAEI
VANARSRSAVLRIAAKR$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAAAAATAGTATGAATGAAACAGACCATAAACATATTACCGTCTTATT
GCATGAAGCAGTTGATGGTTTAGCGATTAAACCGAATGGTATTTATATTG
ATGGTACATTTGGGCGTGGTGGTCATTCACGGCTTATTCTTTCCCGCTTA
GCGACAAACGGTCGTTTAATTGCCATTGATCGTGATCCTTGTGCGATTGC
GGAGGCAAACACGATTAGTGATGCTCGTTTTCAGATTATTCACACCGCTT
TTTCTGCCATTCCTGAAGTGTGTGAAAGTTTGGGATTAATGGGTAAAATT
GACGGAATTTTGCTTGATCTTGGTGTTTCTTCACCACAACTAGATGATGC
AGAACGTGGTTTTAGTTTTATGCGTGATGGGCCTCTAGATATGCGAATGG
ATACCACAAAGGGCTTGTCTGCTGCCGAGTGGCTTGCACAGGTTTCGATA
GAAGATTTGGCTTGGGTATTAAAGACATTTGGTGAAGAGCGTTTTGCAAA
ACGTATTGCACAAGCGGTTGTATCTTATAATAAAACTAACAGTGAAAAGA
TCACTAGAACCTTACAATTAGCTAAAATTATCGCTGATGCAGTGCCTTTC
AAAGATAAACATAAGCACCCAGCGACCCGTTCATTTCAAGCGATTCGGAT
CTTTATTAACCGTGAATTAGATGAACTTGAGAAAGCATTAACCAACGCGT
TGCGGGTATTAGCACCGGAAGGGCGTTTATCTATTATTAGTTTCCATTCG
TTGGAAGATCGAATGGTAAAACAGTTTATGAAGAAAAATAGTAAAGGTGA
AGTGGTACCAAAAGGCTTGCCTATATTAGAAGCAGAATTAAATAAAAATA
TCCCGCTTAATATCATTGGCAAAGCAATTATGCCAAGTGAGGCCGAAATC
GTGGCTAATGCTCGTTCCCGTAGTGCAGTATTACGTATTGCGGCAAAAAG
ATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy