Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR162 IGR165 IGR164 IGR159 IGR161 IGR158 IGR160 IGR157 IGR163 HD0236 otcC,arcB, - HD0232 carA, - HD0235 carB, - HD0233 HD0238 ftsL, - HD0240 mraW, - HD0239 dcuB, - HD0237 ftsI,pbp3,prc, - HD0241 HD0236 otcC,arcB, - HD0232 carA, - HD0235 carB, - HD0233 HD0238 ftsL, - HD0240 mraW, - HD0239 dcuB, - HD0237 ftsI,pbp3,prc, - HD0241 HD0236 otcC,arcB, - HD0232 carA, - HD0235 carB, - HD0233 HD0238 ftsL, - HD0240 mraW, - HD0239 dcuB, - HD0237 ftsI,pbp3,prc, - HD0241
* Calculated from Protein Sequence

Gene ID: HD0235

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
carA  

Definition:
carbamoyl-phosphate synthase, small subunit

Gene Start:
176525

Gene Stop:
175356

Gene Length:
1170

Molecular Weight*:
42736

pI*:
5.90

Net Charge*:
-8.85

EC:
6.3.5.5  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Glutamate metabolism
Pyrimidine metabolism

Secondary Evidence:
Elagoz,A., Abdi,A., Hubert,J.C. and Kammerer,B.
Structure and organisation of the pyrimidine biosynthesis pathway
genes in Lactobacillus plantarum: a PCR strategy for sequencing
without cloning
Gene 182 (1-2), 37-43 (1996)
Medline: 97136688

Quinn,C.L., Stephenson,B.T. and Switzer,R.L.
Functional organization and nucleotide sequence of the Bacillus
subtilis pyrimidine biosynthetic operon
J. Biol. Chem. 266 (14), 9113-9127 (1991)
Medline: 91225016

Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to carbamoyl-phosphate synthase small
chain.Residues 1-385 are 72% similar to this enzyme from Pasteurella multocida (15603367|) and residues 1-388 are 67% similar to this enzyme from Neisseria meningitidis (21759054|).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0505
COG name: Carbamoylphosphate synthase small subunit
Functional Class: E,F
The phylogenetic pattern of COG0505 is amt-YqvceBr-uj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002474 (Carbamoyl-phosphate synthase small chain) with a combined E-value of 1.1e-134.
    IPB002474A    7-13
    IPB002474B    31-59
    IPB002474C    93-135
    IPB002474D    203-229
    IPB002474E    244-255
    IPB002474F    288-327
    IPB002474G    339-380
***** IPB000991 (Glutamine amidotransferase class-I) with a combined E-value of 4.2e-11.
    IPB000991A    274-283
    IPB000991B    357-367


ProDom Summary:  Protein Domain Search
Residues 293-333 are 60% similar to a (PROTEOME SUBUNIT COMPLETE SMALL) protein domain (PD389162) which is seen in Q9WZ28_THEMA.

Residues 309-381 are 80% similar to a (CARBAMOYL-PHOSPHATE SYNTHASE SYNTHETASE SMALL CHAIN) protein domain (PD330440) which is seen in Q9CKV3_PASMU.

Residues 5-171 are 71% similar to a (CARBAMOYL-PHOSPHATE SYNTHASE SYNTHETASE SMALL CHAIN) protein domain (PD001375) which is seen in Q9CKV3_PASMU.

Residues 219-302 are 72% similar to a (CARBAMOYL-PHOSPHATE SYNTHASE SYNTHETASE SMALL CHAIN) protein domain (PD105693) which is seen in O30576_SALTI.



Paralogs:  Local Blast Search
HD0235 is paralogously related to HD1504 (8e-04).


Pfam Summary:  Pfam Search
Residues 4 to 155 (E-value = 8e-78) place HD0235 in the CPSase_sm_chain family which is described as Carbamoyl-phosphate synthase small chain, CPSase domain (PF00988)
Residues 205 to 383 (E-value = 1.8e-66) place HD0235 in the GATase family which is described as Glutamine amidotransferase class-I (PF00117)

PDB Hit:
pdb|1JDB|F Chain F, Carbamoyl Phosphate Synthetase From Escheri... 485 4e-138
pdb|1C30|B Chain B, Crystal Structure Of Carbamoyl Phosphate Sy... 481 6e-137
pdb|1CS0|B Chain B, Crystal Structure Of Carbamoyl Phosphate Sy... 481 8e-137

Gene Protein Sequence:
MFNPAILVLADGSTFYGKSIGYQAVSAYSIGEVVFNTAMTGYQEILTDPS
YAKQIVTLTYPHIGNTGTNDEDNESNQIYASGLIIRDLPLLHSNFRATSS
LSDYLIQHNIIAIADIDTRRLTRILRETGSQAGCIYIPNENESLAQAVEK
AQDLAKSFGSMAGKDLAKEVTCQHRYEWQEGIWHLPTNNAGKPFNLQTTP
TFHVVAYDFGIKQNILRMLAERGCKITVVPAQTSAEDILALNPDGIFLSN
GPGDPEPCTYAIQSIRQLLNTQKPIFGICLGHQLLGLAVGAKTRKMAFGH
HGANHPVQDLKTEHVLITSQNHGFEIDEYSLPENVIVTHRSLFDNSVQGI
ELTNQVAFSFQGHPEANPGPQDVAYLFDKFINAVQATKA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCAACCCTGCAATACTTGTTCTTGCTGATGGCAGTACGTTTTATGG
CAAATCTATAGGCTATCAAGCCGTTTCGGCCTACAGCATTGGTGAAGTCG
TATTTAATACTGCAATGACTGGCTACCAAGAAATTCTCACTGATCCCTCC
TACGCAAAACAAATCGTCACACTCACTTACCCCCATATTGGCAATACTGG
TACAAATGATGAAGATAATGAATCAAATCAAATTTATGCATCAGGTTTAA
TCATTCGAGATCTACCACTTCTCCACAGTAACTTTCGTGCAACTTCTTCT
CTCTCTGACTACCTTATTCAACACAACATTATTGCGATTGCCGATATCGA
TACACGCCGTCTAACTCGAATTTTACGCGAAACTGGCTCACAAGCGGGCT
GTATCTATATACCAAACGAAAATGAATCATTAGCACAAGCGGTCGAAAAA
GCTCAAGATCTTGCAAAAAGTTTTGGCTCTATGGCTGGTAAAGATTTAGC
GAAGGAAGTTACCTGCCAACACCGTTATGAATGGCAAGAAGGTATTTGGC
ACTTACCAACTAATAATGCAGGTAAACCTTTTAATCTCCAAACAACACCG
ACATTTCATGTCGTTGCTTATGATTTTGGCATAAAACAAAATATCTTACG
AATGCTTGCCGAACGTGGTTGTAAAATTACTGTTGTTCCGGCGCAAACCT
CCGCAGAAGATATCCTAGCACTTAATCCTGATGGTATCTTTCTTTCTAAT
GGCCCGGGTGATCCTGAACCTTGTACTTATGCTATTCAATCAATTCGCCA
GCTACTCAATACCCAAAAACCGATCTTTGGCATCTGCTTAGGGCATCAAC
TATTAGGTTTAGCCGTTGGCGCAAAAACACGAAAAATGGCTTTTGGACAT
CATGGTGCTAATCACCCAGTCCAAGACTTAAAAACAGAACACGTTTTAAT
CACAAGCCAAAATCACGGTTTTGAAATAGACGAATATAGTTTGCCTGAAA
ATGTCATAGTCACCCATCGATCTCTTTTTGATAATTCAGTACAAGGCATT
GAACTGACTAACCAAGTCGCCTTTAGTTTCCAAGGCCACCCAGAAGCGAA
TCCAGGGCCACAAGATGTTGCTTATTTATTTGATAAATTTATTAACGCAG
TGCAAGCAACCAAAGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy