Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR162 IGR159 IGR161 IGR158 IGR160 IGR157 IGR163 HD0236 otcC,arcB, - HD0232 carA, - HD0235 carB, - HD0233 HD0238 mraW, - HD0239 dcuB, - HD0237 thiP, - HD0230 HD0236 otcC,arcB, - HD0232 carA, - HD0235 carB, - HD0233 HD0238 mraW, - HD0239 dcuB, - HD0237 thiP, - HD0230 HD0236 otcC,arcB, - HD0232 carA, - HD0235 carB, - HD0233 mraW, - HD0239 dcuB, - HD0237 thiP, - HD0230 thiQ, - HD0231 thiQ, - HD0231 HD0238
* Calculated from Protein Sequence

Gene ID: HD0233

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
carB  

Definition:
carbamoyl-phosphate synthase, large subunit

Gene Start:
175318

Gene Stop:
172091

Gene Length:
3228

Molecular Weight*:
118331

pI*:
5.00

Net Charge*:
-28.00

EC:
6.3.5.5  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Glutamate metabolism
Pyrimidine metabolism

Secondary Evidence:
Martinussen,J. and Hammer,K.
The carB gene encoding the large subunit of carbamoylphosphate
synthetase from Lactococcus lactis is transcribed monocistronically
J. Bacteriol. 180 (17), 4380-4386 (1998)
Medline: 98389648


Elagoz,A., Abdi,A., Hubert,J.C. and Kammerer,B.
Structure and organisation of the pyrimidine biosynthesis pathway
genes in Lactobacillus plantarum: a PCR strategy for sequencing
without cloning
Gene 182 (1-2), 37-43 (1996)
Medline: 97136688

Quinn,C.L., Stephenson,B.T. and Switzer,R.L.
Functional organization and nucleotide sequence of the Bacillus
subtilis pyrimidine biosynthetic operon
J. Biol. Chem. 266 (14), 9113-9127 (1991)
Medline: 91225016

Ghim,S.Y., Nielsen,P. and Neuhard,J.
Molecular characterization of pyrimidine biosynthesis genes from
the thermophile Bacillus caldolyticus
Microbiology 140 (Pt 3), 479-491 (1994)
Medline: 94282293

Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to carbamoyl-phosphate synthase large chain.Residues 1-1057 are 83% similar to this enzyme from Pasteurella multocida (22095528|) and are 77% similar to this enzyme from Neisseria meningitidis (22095531|).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0458
COG name: Carbamoylphosphate synthase large subunit (split gene in MJ)
Functional Class: E,F
The phylogenetic pattern of COG0458 is aMT-YQvceBr-uj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000901 (Carbamoyl-phosphate synthase) with a combined E-value of 8e-13.
    IPB000901    699-722
    IPB000901    159-182


ProDom Summary:  Protein Domain Search
Residues 857-925 are identical to a (CARBAMOYL-PHOSPHATE SYNTHASE SYNTHETASE LIGASE LARGE) protein domain (PD000705) which is seen in Q9CKV0_PASMU.

Residues 839-881 are 72% similar to a (CHAIN BIOSYNTHESIS ATP-BINDING PYRIMIDINE) protein domain (PD375743) which is seen in CARB_PSEAE.

Residues 484-553 are 78% similar to a (CARBAMOYL-PHOSPHATE SYNTHASE SYNTHETASE LIGASE LARGE) protein domain (PD001652) which is seen in Q9CKV0_PASMU.

Residues 408-465 are 86% similar to a (CARBAMOYL-PHOSPHATE SYNTHASE SYNTHETASE LIGASE CHAIN) protein domain (PD001706) which is seen in Q9CKV0_PASMU.

Residues 603-650 are 67% similar to a (CARBAMOYL-PHOSPHATE SYNTHASE SYNTHETASE LIGASE LARGE) protein domain (PD188843) which is seen in Q9RWK0_DEIRA.

Residues 939-997 are 71% similar to a (IMP PURINE BIOSYNTHESIS SYNTHETASE) protein domain (PD002195) which is seen in Q9CKV0_PASMU.

Residues 926-1000 are 62% similar to a (CARBAMOYL-PHOSPHATE LARGE SYNTHASE) protein domain (PD330283) which is seen in Q9JW02_NEIMA.

Residues 603-640 are 89% similar to a (CARBAMOYL-PHOSPHATE SYNTHASE LIGASE SYNTHETASE) protein domain (PD186868) which is seen in Q59599_NEIGO.

Residues 357-403 are 82% similar to a (CARBAMOYL-PHOSPHATE SYNTHASE INCLUDES:) protein domain (PD402775) which is seen in Q9KPH9_VIBCH.

Residues 650-858 are 74% similar to a (LIGASE SYNTHETASE CARBOXYLASE COMPLETE PROTEOME) protein domain (PD000180) which is seen in Q59599_NEIGO.

Residues 554-602 are 95% similar to a (CARBAMOYL-PHOSPHATE SYNTHASE LIGASE SYNTHETASE CHAIN) protein domain (PD000704) which is seen in Q9JXW8_NEIMB.



Paralogs:  Local Blast Search
HD0233 is paralogously related to HD0635 (3e-12) and HD0548 (4e-06).


Pfam Summary:  Pfam Search
Residues 6 to 126 (E-value = 3.5e-57) place HD0233 in the CPSase_L_chain family which is described as Carbamoyl-phosphate synthase L chain, N-terminal domain (PF00289)
Residues 128 to 364 (E-value = 8e-120) place HD0233 in the CPSase_L_D2 family which is described as Carbamoyl-phosphate synthase L chain, ATP binding domain (PF02786)
Residues 419 to 542 (E-value = 1e-64) place HD0233 in the CPSase_L_D3 family which is described as Carbamoyl-phosphate synthetase large chain, oligomerisation domain (PF02787)
Residues 552 to 666 (E-value = 1.3e-22) place HD0233 in the CPSase_L_chain family which is described as Carbamoyl-phosphate synthase L chain, N-terminal domain (PF00289)
Residues 668 to 891 (E-value = 1.5e-24) place HD0233 in the CPSase_L_D2 family which is described as Carbamoyl-phosphate synthase L chain, ATP binding domain (PF02786)
Residues 939 to 1037 (E-value = 5.1e-26) place HD0233 in the MGS family which is described as MGS-like domain (PF02142)

PDB Hit:
pdb|1BXR|A Chain A, Structure Of Carbamoyl Phosphate Synthetase... 1414 0.0
pdb|1CE8|A Chain A, Carbamoyl Phosphate Synthetase From Escheri... 1411 0.0
pdb|1A9X|A Chain A, Carbamoyl Phosphate Synthetase: Caught In T... 1366 0.0

Gene Protein Sequence:
MPKRTDINTILIIGAGPIIIGQACEFDYSGAQAVKALREEGYKVILVNSN
PATIMTDPDMADVTYIEPIQWQTLEKIIEKERPDAILPTMGGQTALNCAL
ALSKNGVLKKYGVELIGATEDAIDKAEDRGRFKDAMTKIGLNTPKSFICH
SFEEAWQAQEQVGFPTLIRPSFTMGGSGGGIAYNRDEFQAICERGFEASP
THELLIEQSVLGWKEYEMEVVRDKADNCIIVCSIENFDPMGVHTGDSITV
APAQTLTDKEYQIMRNASLAVLREIGVDTGGSNVQFAINPANGEMIVIEM
NPRVSRSSALASKATGFPIAKVAAKLAVGYTLNELRNDITGGLIPTSFEP
TIDYVVTKVPRFAFEKFPQADDRLTTQMKSVGEVMAMGRTFQESLQKALR
GLEIGICGFNLRSESPETIRRELANPGPNRILYVADAFGAGFSLEEVHHY
SKIDPWFLIQIQDLVQEEMALEKRAFTELDYAELRRLKRKGFSDKRIAQL
IKVSESDVRAKRYALNLHPVYKRVDTCAGEFKADTAYLYSTYEDECEAKP
TTRQKVMILGGGPNRIGQGIEFDYCCVHAALALREAGFETIMVNCNPETV
STDFDTSDRLYFEPLTLEDVLEIIYKEQPWGVIVHYGGQTPLKLAHALEQ
NGVNIIGTSADSIDAAEDRARFQKILTDLGLKQPNNRTARNAEEAVKLAE
EVGYPLVVRPSYVLGGRAMQIVYNVDELNNYMQEAVSVSNDSPILLDHFL
KNAIEVDVDCICDSEQVLIGGIMQHVEQAGIHSGDSACSLPAYSLTNEVQ
GEIRRQTSAMAFALGVKGLMNVQFAVQNETIYVLEVNPRASRTVPFVSKA
TGNPLAKIAALVMAGKSLAEQNATTEIIPPYFSVKEAVFPFIKFPGVDTT
LSPEMRSTGEVMGTGQSFAEAYYKAQLGAGERIPSTGKVFLSIADEDKPQ
IIRVAQYLQAEGYGLCATIGTAQYLRENGVGVQIINKVREGRPNIVDSIK
NNEIAMIINTVNNLPESIKEAQEIRRNALKLHIPTYTTLAAAEAISEAVR
HINKYDVNALQQLHLSSALANQITR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCAAAGCGTACAGATATAAACACTATATTAATCATTGGTGCAGGCCC
AATCATAATCGGACAAGCCTGTGAATTTGACTATTCAGGCGCACAAGCAG
TTAAAGCATTGCGTGAAGAAGGCTATAAAGTAATATTAGTCAATTCAAAC
CCCGCAACAATTATGACCGATCCTGATATGGCAGATGTCACTTACATCGA
ACCCATTCAATGGCAAACCCTTGAAAAGATCATAGAAAAAGAACGGCCAG
ATGCTATTTTACCTACTATGGGCGGACAAACAGCTCTCAATTGTGCCTTA
GCATTATCTAAAAATGGGGTATTGAAAAAATATGGTGTTGAATTAATTGG
CGCAACTGAAGATGCGATTGATAAAGCAGAAGATAGAGGTCGCTTCAAAG
ATGCAATGACTAAAATCGGCCTGAACACACCAAAATCTTTTATATGCCAT
AGTTTTGAAGAAGCTTGGCAAGCACAGGAACAAGTTGGTTTTCCTACTTT
AATTCGCCCATCATTCACAATGGGTGGTTCTGGCGGTGGCATTGCTTATA
ATCGTGATGAATTCCAAGCTATTTGTGAACGCGGCTTTGAAGCTTCGCCC
ACTCACGAATTACTCATTGAACAGTCTGTGTTAGGCTGGAAAGAATACGA
AATGGAAGTAGTACGTGATAAAGCAGACAACTGTATTATTGTCTGCTCAA
TTGAGAACTTTGATCCAATGGGCGTACATACCGGCGATTCAATCACCGTT
GCACCTGCACAAACATTAACGGACAAAGAATATCAAATTATGCGTAATGC
TTCATTAGCCGTATTACGTGAAATCGGAGTTGATACCGGTGGTTCAAACG
TGCAATTTGCGATCAATCCAGCCAATGGTGAAATGATTGTTATCGAAATG
AATCCTCGTGTCAGCCGATCTTCAGCATTAGCCTCCAAAGCGACCGGTTT
CCCTATCGCTAAAGTTGCCGCAAAATTAGCGGTTGGATATACCTTAAACG
AATTACGTAATGATATTACCGGTGGTTTAATTCCCACGTCATTTGAGCCA
ACGATTGATTATGTTGTCACCAAAGTACCTCGCTTCGCATTTGAAAAATT
TCCTCAAGCGGATGATCGCCTCACTACACAAATGAAGTCTGTTGGTGAGG
TTATGGCAATGGGTAGAACATTCCAAGAATCATTACAAAAAGCATTACGC
GGCTTAGAAATCGGCATTTGCGGCTTTAACTTACGTTCAGAATCCCCTGA
GACTATTCGTCGCGAGCTGGCTAATCCTGGTCCGAACCGTATTCTTTATG
TTGCAGATGCATTTGGTGCAGGCTTCTCACTTGAAGAAGTGCACCACTAT
TCAAAAATTGACCCTTGGTTTTTAATTCAAATTCAAGACTTAGTGCAAGA
AGAAATGGCACTTGAGAAACGTGCTTTTACTGAGCTTGATTATGCAGAAC
TGCGCCGTTTAAAACGCAAAGGTTTCTCGGATAAACGGATTGCACAGCTC
ATCAAAGTCAGTGAAAGTGACGTTAGAGCAAAACGTTATGCTCTCAATTT
GCATCCTGTATATAAACGGGTTGATACGTGTGCGGGCGAATTTAAAGCAG
ATACTGCCTATCTCTATTCAACTTATGAAGATGAATGTGAAGCTAAACCA
ACAACTCGCCAAAAAGTAATGATTTTAGGGGGTGGTCCAAACCGTATCGG
TCAAGGCATTGAATTTGATTACTGTTGTGTGCACGCCGCTTTAGCATTAC
GTGAAGCAGGTTTTGAAACCATTATGGTCAATTGTAATCCTGAGACAGTA
TCAACCGATTTTGATACCTCAGATCGGTTATACTTTGAACCACTGACACT
TGAGGATGTATTAGAAATTATTTATAAAGAGCAACCTTGGGGAGTGATTG
TGCATTATGGTGGGCAAACCCCGTTAAAATTAGCCCATGCATTAGAGCAA
AATGGCGTAAATATTATTGGTACGTCTGCAGACAGTATTGATGCCGCAGA
GGATCGTGCTCGTTTTCAAAAAATCTTAACCGATTTAGGCCTAAAACAGC
CAAATAACCGTACGGCACGCAATGCGGAAGAAGCAGTGAAATTAGCAGAA
GAAGTTGGCTATCCATTAGTTGTGAGACCGTCTTATGTATTAGGCGGTAG
AGCAATGCAAATTGTCTATAATGTAGATGAATTAAACAACTATATGCAAG
AGGCTGTCTCCGTTTCTAATGATAGCCCTATTTTACTTGACCATTTCTTA
AAGAATGCAATTGAAGTCGATGTAGATTGTATTTGCGATTCTGAACAAGT
TTTAATTGGCGGTATTATGCAACACGTTGAACAAGCGGGTATTCATTCTG
GTGATTCAGCCTGTTCATTACCTGCTTATTCATTAACCAATGAAGTTCAA
GGGGAAATTCGCCGCCAAACTTCGGCAATGGCTTTTGCGCTAGGCGTGAA
GGGCTTAATGAACGTCCAATTTGCGGTACAAAATGAGACTATTTATGTAT
TAGAAGTCAACCCTCGTGCAAGCCGTACCGTGCCTTTTGTCAGTAAAGCA
ACGGGTAATCCATTAGCTAAAATTGCTGCCTTAGTGATGGCAGGGAAATC
GTTAGCAGAACAAAATGCTACAACCGAAATTATTCCGCCTTATTTTAGTG
TAAAAGAAGCGGTTTTCCCATTTATCAAATTCCCTGGTGTGGATACGACA
CTCAGCCCAGAAATGCGTTCAACAGGTGAAGTAATGGGAACAGGTCAATC
CTTTGCTGAAGCTTACTATAAAGCGCAGTTAGGTGCTGGTGAACGTATTC
CAAGTACGGGTAAGGTGTTCTTATCTATTGCCGATGAAGACAAACCGCAA
ATTATCCGTGTTGCACAATATTTACAAGCAGAAGGTTATGGTTTATGTGC
CACAATAGGCACAGCACAATATTTACGCGAAAATGGTGTTGGCGTACAAA
TTATAAATAAGGTACGTGAAGGGCGCCCAAATATTGTAGATAGCATCAAA
AATAATGAGATTGCGATGATCATTAATACCGTCAATAATCTGCCTGAAAG
CATTAAAGAAGCACAAGAAATCCGTCGTAATGCATTAAAATTACATATAC
CGACTTATACTACGCTTGCAGCAGCAGAGGCGATCAGTGAAGCAGTCCGC
CATATCAATAAATATGATGTTAATGCACTTCAACAGTTACATCTTTCATC
AGCGCTCGCTAATCAAATAACTCGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy