Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR159 IGR158 IGR157 IGR155 IGR156 ptsH, - HD0229 otcC,arcB, - HD0232 carA, - HD0235 ptsI, - HD0228 carB, - HD0233 thiP, - HD0230 ptsH, - HD0229 otcC,arcB, - HD0232 carA, - HD0235 ptsI, - HD0228 carB, - HD0233 thiP, - HD0230 ptsH, - HD0229 otcC,arcB, - HD0232 carA, - HD0235 ptsI, - HD0228 carB, - HD0233 thiP, - HD0230 thiQ, - HD0231 thiQ, - HD0231
* Calculated from Protein Sequence

Gene ID: HD0232

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
otcC  arcB  

Definition:
ornithine carbamoyltransferase (OTCase)

Gene Start:
171992

Gene Stop:
170988

Gene Length:
1005

Molecular Weight*:
37449

pI*:
6.10

Net Charge*:
-4.30

EC:
2.1.3.3  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Arginine and proline metabolism
Urea cycle and metabolism of amino groups

Secondary Evidence:
Tonon T, Bourdineaud JP, Lonvaud-Funel A.
The arcABC gene cluster encoding the arginine deiminase pathway of Oenococcus oeni, and arginine induction of a
CRP-like gene.
Res Microbiol. 2001 Sep;152(7):653-61.
PMID: 11605985


Shi D, Gallegos R, DePonte J 3rd, Morizono H, Yu X, Allewell NM, Malamy M, Tuchman M.
Crystal structure of a transcarbamylase-like protein from the anaerobic bacterium Bacteroides fragilis at 2.0 A resolution.
J Mol Biol. 2002 Jul 19;320(4):899-908.
PMID: 12095263

Comment:
Should not be confused with ArcB involved in a two component system.

Blast Summary:  PSI-Blast Search
Residues 19 to 352 are 81% ( EScore : 1e-160 ) identical to sp|P44770|OTCC_HAEIN ORNITHINE CARBAMOYLTRANSFERASE, CATABOLIC between residues 1 and 334 in [Haemophilus influenzae Rd]
Residues 19 to 352 are 80% ( EScore : 1e-157 ) identical to gb|AAD01405.1| (AF007428) ornithine carbamoyltransferase homolog between residues 1 and 334 in [Haemophilus paragallinarum]
Residues 19 to 352 are 73% ( EScore : 1e-143 ) identical to sp|P08308|OTCC_PSEAE ORNITHINE CARBAMOYLTRANSFERASE, CATABOLIC between residues 1 and 334 in [Pseudomonas aeruginosa]
Residues 20 to 352 are 73% ( EScore : 1e-142 ) identical to pdb|1ORT|A between residues 1 and 333
Residues 22 to 351 are 66% ( EScore : 1e-123 ) identical to emb|CAB84990.1| (AL162757) ornithine transcarbamoylase between residues 2 and 329 in [Neisseria meningitidis]
Residues 22 to 351 are 65% ( EScore : 1e-122 ) identical to gb|AAD32177.1|AF125563_2 ornithine carbomyltransferase between residues 2 and 329 in [Neisseria meningitidis]
Residues 22 to 351 are 65% ( EScore : 1e-122 ) identical to gb|AAF41926.1| (AE002508) ornithine carbamoyltransferase, catabolic between residues 2 and 329 in [Neisseria meningitidis MC58]
Residues 22 to 351 are 65% ( EScore : 1e-122 ) identical to sp|P21302|OTCC_NEIGO ORNITHINE CARBAMOYLTRANSFERASE, CATABOLIC between residues 2 and 329 in [Neisseria gonorrhoeae]
Residues 19 to 351 are 62% ( EScore : 1e-120 ) identical to sp|O31018|OTCC_RHIET ORNITHINE CARBAMOYLTRANSFERASE, CATABOLIC between residues 1 and 332 in [Rhizobium etli]
Residues 62 to 342 are 69% ( EScore : 1e-111 ) identical to pir||S24720 between residues 2 and 280

COGS Summary:  COGS Search
BeTs to 13 clades of COG0078
COG name: Ornithine carbamoyltransferase
Functional Class:  E
The phylogenetic pattern of COG0078 is amtkyqvcEbrh---po----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002029 (Aspartate and ornithine carbamoyltransferase family) with a combined E-value of 4.8e-58.
    IPB002029A    46-73
    IPB002029B    83-108
    IPB002029C    125-163
    IPB002029D    265-286


ProDom Summary:  Protein Domain Search
Residues 9-148 are 82% similar to a (CARBAMOYLTRANSFERASE ASPARTATE ORNITHINE BIOSYNTHESIS) protein domain (PD000708) which is seen in OTCC_HAEIN.

Residues 149-202 are 79% similar to a (ORNITHINE CARBAMOYLTRANSFERASE ARGININE) protein domain (PD407303) which is seen in OTCC_HAEIN.

Residues 254-334 are 86% similar to a (ORNITHINE CARBAMOYLTRANSFERASE ARGININE OTCASE CATABOLIC) protein domain (PD244504) which is seen in OTCC_HAEIN.

Residues 254-333 are 48% similar to a (ORNITHINE TRANSFERASE) protein domain (PD414068) which is seen in O53089_LACSK.

Residues 160-284 are 40% similar to a (ASPARTATE CARBAMOYLTRANSFERASE BIOSYNTHESIS ORNITHINE) protein domain (PD124925) which is seen in OTCA_THEMA.

Residues 203-253 are 74% similar to a (ORNITHINE CARBAMOYLTRANSFERASE ARGININE) protein domain (PD404865) which is seen in OTCC_HAEIN.



Paralogs:  Local Blast Search
HD0232 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 8 to 150 (E-value = 3.9e-82) place HD0232 in the OTCace_N family which is described as Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain (PF02729)
Residues 154 to 333 (E-value = 2.8e-85) place HD0232 in the OTCace family which is described as Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain (PF00185)

PDB Hit:
pdb|1DXH|A Chain A, Catabolic Ornithine Carbamoyltransferase Fr... 507 9e-145
pdb|1ORT|A Chain A, Ornithine Transcarbamoylase From Pseudomona... 505 3e-144
pdb|1DUV|G Chain G, Crystal Structure Of E. Coli Ornithine Tran... 401 5e-113

Gene Protein Sequence:
MAFNLKNRHLLSLVNHTEREIKYLLALARDLKRAKYSGTEQQTLKGKNIA
LIFEKTSTRTRCAFEVAAYDQGAQVTYIDPNSSQIGHKESMKDTARVLGR
MYDAIQYRGFKQATVNELAKYAGVPVFNGLTDEFHPTQMLADVLTMLENC
EKPLNQISYVYMGDARNNMGNSLLLIGAKLGMDVRICAPQALLPEDSLVT
LCQQFAQQSNARITITDDIDLAIQGVDFIHTDVWVSMGEPLETWGERINM
LMPYQVTPALMQRTGNPNVKFMHCLPAFHNSETTMGKQIAEQYPQLANGI
EVIEEVFESSANIAFEQAENRMHTIKAVMVASLA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTTTTAATCTTAAAAATAGACACTTGCTCAGCTTAGTCAATCACAC
AGAACGTGAAATTAAATACTTATTAGCATTAGCACGTGATTTAAAACGTG
CAAAATATAGCGGTACTGAACAACAAACATTAAAAGGCAAAAATATTGCT
TTAATCTTTGAAAAAACATCTACCCGTACCCGTTGTGCGTTTGAAGTTGC
CGCTTATGATCAAGGTGCCCAAGTCACTTATATTGATCCAAACTCCTCTC
AAATTGGCCATAAAGAATCAATGAAAGACACTGCACGTGTATTAGGCAGA
ATGTATGATGCCATTCAATATCGTGGTTTTAAACAAGCCACTGTAAATGA
ATTAGCCAAATATGCGGGAGTGCCTGTTTTTAATGGTTTAACTGATGAAT
TCCATCCAACACAGATGCTCGCTGATGTATTAACTATGCTTGAAAATTGT
GAAAAACCATTAAATCAAATAAGCTATGTCTATATGGGTGATGCACGCAA
TAATATGGGTAATTCTTTATTACTTATTGGTGCTAAATTAGGTATGGACG
TCCGTATTTGTGCACCTCAAGCCTTACTGCCAGAAGACTCCTTGGTCACA
CTATGCCAACAATTTGCTCAACAATCTAACGCGCGCATTACCATCACAGA
TGATATAGATCTAGCAATACAAGGGGTCGATTTTATTCATACTGATGTAT
GGGTATCAATGGGTGAGCCGTTAGAGACGTGGGGCGAACGAATTAATATG
TTAATGCCTTATCAAGTGACTCCTGCGCTAATGCAACGTACAGGCAATCC
AAACGTAAAATTTATGCATTGTTTACCCGCTTTCCATAATAGTGAAACCA
CAATGGGTAAACAAATTGCTGAACAGTATCCACAGCTTGCAAACGGTATT
GAAGTAATAGAAGAAGTTTTTGAATCCAGTGCAAATATCGCCTTTGAACA
AGCTGAAAATCGAATGCACACCATTAAAGCCGTAATGGTAGCCAGCTTAG
CATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy