Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR159 IGR154 IGR158 IGR157 IGR155 IGR153 IGR156 ptsH, - HD0229 crr, - HD0227 otcC,arcB, - HD0232 carA, - HD0235 ptsI, - HD0228 carB, - HD0233 thiP, - HD0230 ptsH, - HD0229 crr, - HD0227 otcC,arcB, - HD0232 carA, - HD0235 ptsI, - HD0228 carB, - HD0233 thiP, - HD0230 ptsH, - HD0229 crr, - HD0227 otcC,arcB, - HD0232 carA, - HD0235 ptsI, - HD0228 carB, - HD0233 thiP, - HD0230 thiQ, - HD0231 thiQ, - HD0231
* Calculated from Protein Sequence

Gene ID: HD0231

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
thiQ  

Definition:
thiamine transport ATP-binding protein

Gene Start:
170221

Gene Stop:
170862

Gene Length:
642

Molecular Weight*:
23900

pI*:
5.70

Net Charge*:
-3.84

EC:
 

Functional Class:
Transport and binding proteins; ABC Superfamily: ATP-binding protein  

Pathway: pathway table

Secondary Evidence:
Webb,E., Claas,K. and Downs,D.
thiBPQ encodes an ABC transporter required for transport of
thiamine and thiamine pyrophosphate in Salmonella typhimurium
J. Biol. Chem. 273 (15), 8946-8950 (1998)
Medline: 98204886


Comment:
For other components see HD0230 (MSD1) (MSD2) and HD0601 (SBP1).

From Genbank:[gi:1175488]
This protein is part of the binding-protein-dependent transport system TBPA-THIPQ for thiamine and TPP.It is probably responsible for energy coupling to the transport system.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to thiamin transport ATP-binding protein sequences,e.g.residues 5-207 are 54% similar to thiamin transport ATP-binding protein in Haemophilus influenzae strain Rd KW20 (1175488|).

Residues 5-207 are 53% similar to thiamin transport ATP-binding protein in Escherichia coli (2506108|).

COGS Summary:  COGS Search
BeTs to 4 clades of COG1118
COG name: ABC-type sulfate/molybdenum transport system, ATPase component
Functional Class: P
The phylogenetic pattern of COG1118 is amtk---cE-rH-------n-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001140 (ABC transporter transmembrane region) with a combined E-value of 1.7e-32.
    IPB001140A    13-59
    IPB001140B    126-164
    IPB001140C    182-211


ProDom Summary:  Protein Domain Search
Residues 70-124 are 63% similar to a (ATP-BINDING TRANSPORT COMPLETE PROTEOME TRANSPORTER ABC) protein domain (PD007166) which is seen in THIQ_ECOLI.

Residues 128-171 are 79% similar to a (ATP-BINDING TRANSPORT ABC TRANSPORTER COMPLETE PROTEOME) protein domain (PD000006) which is seen in Q9CNP9_PASMU.



Paralogs:  Local Blast Search
HD0231 is paralogously related to HD1826 (3e-31), HD0572 (4e-31), HD1098 (6e-28), HD2032 (1e-26), HD1019 (7e-26), HD0811 (6e-25), HD1630 (4e-21), HD1672 (6e-21), HD0860 (1e-20), HD0586 (9e-20), HD0259 (6e-19), HD1651 (7e-18), HD0316 (7e-18), HD0982 (6e-17), HD1817 (5e-16), HD1652 (9e-16), HD0863 (2e-15), HD0315 (1e-14), HD1820 (6e-13), HD1745 (2e-12), HD1338 (4e-12), HD0786 (2e-11), HD0224 (2e-10), HD1768 (1e-09), HD1671 (2e-09) and HD1235 (2e-07).


Pfam Summary:  Pfam Search
Residues 24 to 205 (E-value = 6.1e-61) place HD0231 in the ABC_tran family which is described as ABC transporter (PF00005)

PDB Hit:
pdb|1G29|1 Chain 1, Malk >gi|12084695|pdb|1G29|2 Chain 2, Malk 116 2e-027
pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permea... 95 8e-021

Gene Protein Sequence:
MIELNVTFDYEQMPMHFILQVAKAQRVAVVGESGAGKSTLLNLIAGFDLA
TSGQILLNEVDYTFAEVADRPVSMLFQENNVFPHLTVEQNIGLALVPRLH
LTPQQQQAVKKIAGQMGIAELLLRRADQLSGGQKQRVALARTLLQDKPIL
LLDEPFSALDPIRRNELQQLVLEICRQRQLTLLMVTHQFSESEALFDRVI
HIEQGRIVADQLL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTGAATTAAATGTAACGTTTGATTATGAACAAATGCCAATGCACTT
TATCTTGCAAGTGGCTAAAGCACAACGGGTGGCTGTCGTGGGTGAAAGTG
GCGCTGGTAAAAGTACATTATTAAATTTGATTGCGGGTTTTGATTTGGCG
ACTAGCGGGCAGATTTTGTTGAATGAAGTCGATTATACTTTTGCAGAAGT
GGCAGATCGTCCAGTGTCGATGTTATTTCAAGAAAATAATGTTTTTCCTC
ATTTGACTGTTGAGCAAAATATTGGTTTAGCGTTGGTGCCTCGCTTGCAT
TTAACGCCACAACAGCAACAGGCGGTAAAAAAGATTGCTGGTCAAATGGG
GATTGCTGAATTGTTATTACGGCGAGCGGATCAATTATCGGGAGGGCAAA
AACAACGGGTTGCGTTGGCCCGTACTTTGTTACAAGATAAGCCTATTCTG
TTATTAGATGAACCTTTTTCTGCGTTGGATCCTATTCGGCGTAATGAATT
GCAACAGTTGGTGTTAGAGATTTGCCGTCAGCGTCAATTAACGCTATTAA
TGGTGACCCATCAATTTTCAGAAAGTGAGGCATTATTCGATCGTGTTATT
CATATTGAACAGGGACGGATTGTTGCGGATCAATTGCTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy