Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR154 IGR158 IGR157 IGR155 IGR153 IGR156 ptsH, - HD0229 crr, - HD0227 otcC,arcB, - HD0232 HD0226 ptsI, - HD0228 carB, - HD0233 thiP, - HD0230 ptsH, - HD0229 crr, - HD0227 otcC,arcB, - HD0232 HD0226 ptsI, - HD0228 carB, - HD0233 thiP, - HD0230 ptsH, - HD0229 crr, - HD0227 otcC,arcB, - HD0232 HD0226 ptsI, - HD0228 carB, - HD0233 thiP, - HD0230 thiQ, - HD0231 thiQ, - HD0231
* Calculated from Protein Sequence

Gene ID: HD0230

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
thiP  

Definition:
thiamin ABC transporter, permease protein

Gene Start:
168620

Gene Stop:
170224

Gene Length:
1605

Molecular Weight*:
60240

pI*:
10.10

Net Charge*:
13.20

EC:
 

Functional Class:
Transport and binding proteins; ABC Superfamily: membrane spanning permease  

Pathway: pathway table

Secondary Evidence:
Webb,E., Claas,K. and Downs,D.
thiBPQ encodes an ABC transporter required for transport of
thiamine and thiamine pyrophosphate in Salmonella typhimurium
J. Biol. Chem. 273 (15), 8946-8950 (1998)
Medline: 98204886


Comment:
For other components see HD0231 (NBD1); HD0230 (MSD2) and HD0601 (SBP1).

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to thiamin ABC transporters. Residues 69-531 are 38% similar to these transporters from Pasteurella multocida (7716537|) and residues 70-513 are also 38% similar to these transporters from Haemophilus influenzae (16272954|).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1178
COG name: Uncharacterized transport system, permease component
Functional Class: R
The phylogenetic pattern of COG1178 is ---k----e--H-----l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 70-146 are 58% similar to a (TRANSPORT PERMEASE COMPLETE PROTEOME TRANSMEMBRANE) protein domain (PD002244) which is seen in THIP_HAEIN.

Residues 419-513 are 46% similar to a (TRANSPORT PERMEASE SYSTEM TRANSMEMBRANE) protein domain (PD404541) which is seen in THIP_HAEIN.

Residues 419-520 are 40% similar to a (TRANSPORT PERMEASE COMPLETE PROTEOME TRANSMEMBRANE) protein domain (PD349044) which is seen in Q9KP41_VIBCH.

Residues 147-247 are 56% similar to a (ABC TRANSPORTER THIAMINE COMPLETE) protein domain (PD151368) which is seen in Q9L6A1_PASMU.



Paralogs:  Local Blast Search
HD0230 is paralogously related to HD0574 (5e-08) and HD1824 (2e-06).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LVDGEIMLRSLTKFSAWLVYLGIVLLYLFSLFALLNHRQGESDWQWSEMW
PILKYSLLQAGLSAGLATIFAVLLARSFFYLQFKGKALLYKVISFVWVLP
SLVVIFAIIGVWGNAGWLAQLANLLGLEWQFSLYGLQGILLAHLLFNVPL
VTKYCLEGLRLIPSSQHKLAAQLTLRGWAYFRIVEWPTLSGILPYSFANV
FLICFTSFPIVLMLGGSPKYSTLEVAIYQAVTFEFDFSKATMLIITQLFV
GMLLQLMMDLASKTAFKHKKQTPPAVDHIWLPKVTGKAKYGLQAVLFLQS
LAIILPLISVISSALQVSNFWQRLANDALWQATWFSLWLSVIAASTVVAL
AYLLALETRQQSYRQQKMGYSILSGVVNYPLVLPIFLLAVGLFLLLMEVD
LSTTQLLWLVGVCNGLSLLPYIYRLLFATMWQVFVAQDQLARNLGLCGLR
RWWIVEKHYLIRPLINAFCLAMSASLGSFAVIAFFGSPDFSSLPYLLYQQ
LGNYRTEDAAVTALVLMLFALLPFFLIKQQESLK$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGTTGATGGGGAAATTATGTTACGTTCGCTCACTAAATTTAGTGCTTG
GCTTGTTTATTTAGGTATAGTTTTACTTTATCTGTTTAGTTTGTTTGCGT
TACTCAATCATCGTCAAGGTGAGAGTGATTGGCAATGGTCAGAAATGTGG
CCTATTTTAAAATATAGCTTGTTACAAGCGGGGCTTTCGGCAGGATTAGC
CACTATTTTTGCTGTATTGTTAGCGCGTTCATTTTTTTATTTGCAGTTTA
AAGGCAAAGCGTTGCTATATAAGGTGATCTCGTTTGTTTGGGTTTTACCG
TCATTGGTTGTGATTTTTGCCATTATTGGCGTTTGGGGCAATGCTGGTTG
GTTAGCCCAACTTGCCAATTTGCTCGGTTTGGAGTGGCAATTTTCACTTT
ATGGTTTACAAGGCATTTTGTTAGCGCATTTATTATTTAATGTTCCGTTA
GTCACTAAATATTGTTTGGAAGGATTGCGGTTAATTCCAAGTAGTCAGCA
TAAATTAGCCGCGCAGTTAACATTGCGAGGTTGGGCTTATTTTCGTATTG
TGGAATGGCCAACATTAAGTGGCATTTTGCCTTATAGCTTTGCGAATGTG
TTTTTGATTTGTTTTACTAGTTTTCCGATTGTGTTGATGTTAGGCGGTAG
CCCTAAATATAGCACGTTAGAAGTGGCAATTTATCAAGCGGTTACATTTG
AATTTGATTTTTCCAAAGCAACGATGTTGATTATTACCCAGCTATTTGTA
GGAATGTTGTTGCAGTTAATGATGGATTTGGCCAGTAAAACGGCGTTTAA
ACATAAAAAACAAACACCGCCAGCAGTGGATCATATTTGGTTGCCTAAGG
TAACGGGTAAAGCTAAATATGGATTGCAAGCGGTACTTTTTTTGCAAAGT
TTAGCCATTATTTTACCGCTAATCAGTGTGATCAGCTCAGCTTTGCAGGT
ATCAAACTTTTGGCAACGGCTAGCAAATGATGCTTTATGGCAGGCGACTT
GGTTCTCGTTATGGTTAAGTGTAATTGCGGCTTCAACAGTGGTTGCGCTT
GCTTATTTATTGGCATTAGAAACGCGCCAACAAAGTTACCGTCAGCAGAA
AATGGGGTACAGTATTTTGAGTGGGGTCGTGAATTATCCGTTAGTTTTGC
CGATTTTTTTATTAGCGGTGGGGTTATTTTTGTTATTGATGGAGGTGGAT
TTAAGCACCACGCAATTGCTTTGGTTAGTCGGCGTTTGTAACGGCTTGAG
CCTATTGCCTTATATTTATCGTTTATTATTTGCGACAATGTGGCAAGTGT
TTGTGGCACAAGACCAGTTAGCTCGCAATTTAGGATTATGTGGTTTACGG
CGATGGTGGATTGTGGAAAAACATTATTTAATTCGACCGCTTATCAATGC
ATTTTGTTTGGCTATGTCAGCCAGTTTAGGTAGTTTTGCTGTGATTGCTT
TTTTTGGCAGTCCAGATTTTAGTTCATTACCTTATCTACTTTATCAACAA
TTAGGCAACTATCGTACAGAAGACGCGGCGGTAACCGCTTTGGTATTAAT
GCTATTTGCCTTGTTGCCTTTTTTCCTGATTAAACAACAAGAGAGCCTAA
AATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy