Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR152 IGR154 IGR158 IGR157 IGR155 IGR153 IGR156 ptsH, - HD0229 crr, - HD0227 otcC,arcB, - HD0232 HD0226 yjjK, - HD0224 ptsI, - HD0228 carB, - HD0233 thiP, - HD0230 ptsH, - HD0229 crr, - HD0227 otcC,arcB, - HD0232 HD0226 yjjK, - HD0224 ptsI, - HD0228 carB, - HD0233 thiP, - HD0230 ptsH, - HD0229 crr, - HD0227 otcC,arcB, - HD0232 HD0226 yjjK, - HD0224 ptsI, - HD0228 carB, - HD0233 thiP, - HD0230 thiQ, - HD0231 thiQ, - HD0231
* Calculated from Protein Sequence

Gene ID: HD0229

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ptsH  

Definition:
phosphocarrier protein HPr (histidine-containing protein)

Gene Start:
168420

Gene Stop:
168106

Gene Length:
315

Molecular Weight*:
11187

pI*:
5.90

Net Charge*:
-0.82

EC:
2.7.1.68  

Functional Class:
Transport and binding proteins; Carbohydrates, organic alcohols, and acids  

Pathway: pathway table
Inositol phosphate metabolism

Secondary Evidence:
De Reuse,H. and Danchin,A.
The ptsH, ptsI, and crr genes of the Escherichia coli
phosphoenolpyruvate-dependent phosphotransferase system: a complex
operon with several modes of transcription
J. Bacteriol. 170 (9), 3827-3837 (1988)
Medline: 88314869

De Reuse,H., Roy,A. and Danchin,A.
Analysis of the ptsH-ptsI-crr region in Escherichia coli K-12:
nucleotide sequence of the ptsH gene
Gene 35 (1-2), 199-207 (1985)
Medline: 85286351

Saffen,D.W., Presper,K.A., Doering,T.L. and Roseman,S.
Sugar transport by the bacterial phosphotransferase system.
Molecular cloning and structural analysis of the Escherichia coli
ptsH, ptsI, and crr genes
J. Biol. Chem. 262 (33), 16241-16253 (1987)
Medline: 88058992


Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to PTS system protein HPr. Residues 20-104 are 75% similar to this protein from Pasteurella multocida (15602763|) and are 68% similar to this protein from E.coli (1799834|).

COGS Summary:  COGS Search
BeTs to 6 clades of COG1925
COG name: Phosphotransferase system, HPr-related proteins
Functional Class: G
The phylogenetic pattern of COG1925 is --------EB-H--gpOlin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001020 (Histidine phosphorylation site in HPr protein) with a combined E-value of 2.4e-34.
    IPB001020A    27-54
    IPB001020B    58-96
***** PR00107 (Phosphocarrier protein signature) with a combined E-value of 6e-26.
    PR00107A    32-48
    PR00107B    57-72
    PR00107C    72-89
***** IPB002114 (Serine phosphorylation site in HPr protein) with a combined E-value of 3.3e-08.
    IPB002114A    21-51
    IPB002114B    63-104


ProDom Summary:  Protein Domain Search
Residues 20-96 are 74% similar to a (PHOSPHOTRANSFERASE HPR SYSTEM PHOSPHOCARRIER) protein domain (PD002238) which is seen in Q9CMD2_PASMU.



Paralogs:  Local Blast Search
HD0229 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 20 to 103 (E-value = 7.2e-37) place HD0229 in the PTS-HPr family which is described as PTS HPr component phosphorylation site (PF00381)

PDB Hit:
pdb|1GGR|B Chain B, Complex Of Enzyme Iiaglc And The Histidine-... 116 8e-028
pdb|1OPD| Histidine-Containing Protein (Hpr), Mutant With Se... 116 1e-027
pdb|1CM2|A Chain A, Structure Of His15asp Hpr After Hydrolysis ... 113 9e-027

Gene Protein Sequence:
MDLIICFNFPTFRISRGIFMYSKDVVITAPNGLHTRPAAEFVKAAKGFAS
DITVTSGSKSSSAKSLFKLQTLGLTQGTSITISAEGEDEQKAVDFLVDLI
PTLE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTTAATTATCTGTTTCAACTTTCCCACTTTTAGAATCTCAAGAGG
AATTTTTATGTACTCAAAAGACGTTGTTATTACAGCACCAAATGGTTTAC
ACACTCGTCCAGCAGCAGAATTTGTTAAAGCAGCTAAAGGTTTTGCTTCT
GACATTACTGTAACTTCAGGTAGCAAAAGTTCAAGTGCAAAAAGTCTCTT
TAAACTCCAAACATTAGGTCTTACGCAAGGTACATCTATTACTATCTCTG
CGGAAGGTGAAGACGAACAGAAAGCGGTCGATTTCTTAGTAGACTTAATC
CCTACTTTAGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy