Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR151 IGR152 IGR154 IGR158 IGR157 IGR155 IGR153 IGR156 ptsH, - HD0229 crr, - HD0227 dnaQ, - HD0223 otcC,arcB, - HD0232 HD0226 yjjK, - HD0224 ptsI, - HD0228 carB, - HD0233 thiP, - HD0230 ptsH, - HD0229 crr, - HD0227 dnaQ, - HD0223 otcC,arcB, - HD0232 HD0226 yjjK, - HD0224 ptsI, - HD0228 carB, - HD0233 thiP, - HD0230 ptsH, - HD0229 crr, - HD0227 dnaQ, - HD0223 otcC,arcB, - HD0232 HD0226 yjjK, - HD0224 ptsI, - HD0228 carB, - HD0233 thiP, - HD0230 thiQ, - HD0231 thiQ, - HD0231
* Calculated from Protein Sequence

Gene ID: HD0228

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ptsI  

Definition:
phosphoenolpyruvate-protein phosphotransferase (ptsI)

Gene Start:
167975

Gene Stop:
166254

Gene Length:
1722

Molecular Weight*:
63231

pI*:
4.70

Net Charge*:
-27.36

EC:
2.7.3.9  

Functional Class:
Transport and binding proteins; Carbohydrates, organic alcohols, and acids  

Pathway: pathway table

Secondary Evidence:
De Reuse,H. and Danchin,A.
The ptsH, ptsI, and crr genes of the Escherichia coli
phosphoenolpyruvate-dependent phosphotransferase system: a complex
operon with several modes of transcription
J. Bacteriol. 170 (9), 3827-3837 (1988)
Medline: 88314869

Saffen,D.W., Presper,K.A., Doering,T.L. and Roseman,S.
Sugar transport by the bacterial phosphotransferase system.
Molecular cloning and structural analysis of the Escherichia coli
ptsH, ptsI, and crr genes
J. Biol. Chem. 262 (33), 16241-16253 (1987)
Medline: 88058992



Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to phosphoenolpyruvate-protein phosphotransferase (ptsI). Residues 1-568 are 72% similar to this enzyme from Haemophilus influenzae (16273599|) and residues 1-571 are 72% similar to this enzyme from Pasteurella multocida (15602762|).

COGS Summary:  COGS Search
BeTs to 5 clades of COG1080
COG name: Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria)
Functional Class: G
The phylogenetic pattern of COG1080 is --------Eb-h--gpo-in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000121 (PEP-utilizing enzyme) with a combined E-value of 1.8e-79.
    IPB000121A    76-86
    IPB000121B    178-204
    IPB000121C    288-300
    IPB000121D    350-361
    IPB000121E    388-398
    IPB000121F    431-467
    IPB000121G    496-509
***** IPB002192 (Pyruvate phosphate dikinase, PEP/pyruvate binding domain) with a combined E-value of 5.8e-41.
    IPB002192E    178-204
    IPB002192G    270-301
    IPB002192I    350-359
    IPB002192J    373-398
    IPB002192K    433-467
    IPB002192L    496-513
***** IPB002114 (Serine phosphorylation site in HPr protein) with a combined E-value of 7.5e-11.
    IPB002114B    496-539


ProDom Summary:  Protein Domain Search
Residues 157-504 are 80% similar to a (PHOSPHOTRANSFERASE KINASE DIKINASE PYRUVATE SYSTEM) protein domain (PD000940) which is seen in Q9CMD3_PASMU.

Residues 1-154 are 60% similar to a (PHOSPHOTRANSFERASE SYSTEM ENZYME I) protein domain (PD190342) which is seen in PT1_HAEIN.

Residues 505-568 are 65% similar to a (PHOSPHOTRANSFERASE SYSTEM I ENZYME) protein domain (PD003206) which is seen in PT1_HAEIN.



Paralogs:  Local Blast Search
HD0228 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 127 (E-value = 3e-53) place HD0228 in the PEP-utilisers_N family which is described as PEP-utilising enzyme, N-terminal (PF05524)
Residues 144 to 225 (E-value = 2.2e-36) place HD0228 in the PEP-utilizers family which is described as PEP-utilising enzyme, mobile domain (PF00391)
Residues 250 to 542 (E-value = 1.8e-180) place HD0228 in the PEP-utilizers_C family which is described as PEP-utilising enzyme, TIM barrel domain (PF02896)

PDB Hit:
pdb|1EZA| Amino Terminal Domain Of Enzyme I From Escherichia... 317 2e-087
pdb|1ZYM|B Chain B, Amino Terminal Domain Of Enzyme I From Esch... 317 2e-087
pdb|3EZA|A Chain A, Complex Of The Amino Terminal Domain Of Enz... 304 2e-083

Gene Protein Sequence:
MITGIAASPGAVFGKALVLKEEPIVLNTKKITADQIEIEKEKFFAGRAKA
AAQLTAIKEKARHTLGEEKEAIFEGHLMILEDEELEEEILEFITNNLVTA
DFATHKIIEMQATMLAEIDDEYLKERATDLRDIGNRLLRNILNMYIVDLG
DIQEEVILVAYDLTPSETAQLNLDKVLGFVTDIGGRTSHTSIMARSLELP
AIVGTNNITEQVKTGDILILDAINNQIKINPSVDEISAFKAIQAKVEAEK
AELVQLKDLAAETLDGHKIEVAGNIGTIRDIGGVLRNGGESIGLYRTEFL
FMDRCELPDEEEQFEAYKEIVEAMQGKQVILRTMDIGGDKELPYLNLPKE
MNPFLGWRAIRIGLTRREILDTQLRAVLRASAFGKLAVMFPMIISVEEIR
ELKAIVAELKAQLRAEGKAFDEHLQLGIMVETPSAAVNARHLAKEVDFFS
IGTNDLTQYTLAVDRGNEIIAHLYNPLSPSVLNLIKQVIDASHAEGKWTG
MCGELAGDVRATALLLGMGLDEFSMSAISVPHVKKLARSIHYTDAKALAD
EALAQPTVADVERLVNAFYAKLN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTACAGGTATTGCTGCATCACCAGGTGCTGTATTTGGCAAGGCACT
CGTTTTAAAAGAAGAACCTATTGTACTAAATACTAAAAAAATTACCGCTG
ATCAAATTGAAATTGAAAAAGAAAAATTTTTCGCAGGGCGAGCCAAGGCT
GCGGCACAATTAACCGCAATTAAAGAAAAGGCAAGACATACATTAGGTGA
AGAAAAAGAAGCGATCTTTGAAGGCCATTTAATGATCCTAGAAGATGAAG
AACTAGAAGAAGAAATCCTAGAATTCATTACCAACAACCTAGTTACTGCA
GACTTCGCCACGCATAAAATTATTGAAATGCAAGCAACAATGTTGGCGGA
AATTGACGATGAATACCTAAAAGAACGTGCCACAGATTTACGCGATATCG
GTAACCGCTTATTACGTAATATTTTAAATATGTATATTGTTGATCTTGGC
GATATTCAAGAAGAAGTTATTCTAGTGGCTTACGATCTTACACCATCAGA
AACAGCCCAATTAAACTTAGATAAAGTATTAGGCTTCGTGACTGATATTG
GCGGCCGCACATCACATACCTCAATTATGGCACGTTCGTTAGAATTGCCC
GCAATAGTTGGCACGAATAACATTACCGAACAAGTCAAAACCGGCGATAT
TTTAATCTTAGATGCAATTAACAATCAGATCAAAATCAATCCATCTGTAG
ATGAAATTTCCGCATTTAAAGCCATACAAGCAAAAGTTGAAGCAGAAAAA
GCAGAGTTAGTCCAATTAAAAGATTTAGCTGCTGAAACGTTGGATGGTCA
TAAAATTGAAGTGGCTGGCAATATCGGCACAATTCGTGATATTGGTGGCG
TACTACGCAATGGCGGAGAATCTATAGGCTTATATCGCACCGAATTCTTA
TTTATGGATCGTTGTGAATTGCCTGATGAAGAAGAACAATTCGAAGCCTA
TAAAGAAATTGTCGAAGCAATGCAAGGCAAACAAGTTATTCTACGCACAA
TGGACATTGGCGGTGATAAAGAATTACCTTATTTAAATTTACCCAAAGAA
ATGAATCCTTTCTTAGGTTGGCGTGCAATCCGTATTGGCTTAACTCGCCG
TGAAATCTTAGATACGCAATTACGAGCAGTGTTACGAGCTTCTGCTTTCG
GCAAATTAGCGGTCATGTTTCCAATGATTATTTCAGTAGAAGAAATTCGT
GAATTAAAAGCAATCGTTGCCGAATTAAAAGCACAATTACGCGCGGAAGG
AAAAGCATTTGATGAACATTTACAGCTTGGTATTATGGTAGAAACACCAT
CTGCAGCAGTAAACGCCCGCCATTTAGCTAAAGAAGTCGATTTCTTTAGC
ATTGGGACTAACGACTTAACGCAATATACATTAGCCGTTGACCGTGGCAA
TGAGATTATCGCACATTTATATAACCCATTAAGCCCATCAGTTTTAAACT
TAATAAAACAAGTGATTGATGCCTCGCACGCCGAAGGTAAATGGACCGGT
ATGTGCGGCGAATTAGCCGGCGATGTACGCGCTACCGCCCTCCTATTAGG
AATGGGATTAGATGAGTTTAGTATGAGTGCCATCTCTGTTCCGCACGTCA
AAAAATTAGCCCGCTCTATTCACTACACTGATGCAAAAGCCTTAGCGGAT
GAAGCATTAGCTCAGCCAACGGTCGCAGATGTTGAACGATTAGTGAATGC
CTTTTACGCTAAACTAAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy