Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Asp-2 IGR151 IGR152 IGR154 IGR157 IGR155 IGR153 IGR156 IGR150 ptsH, - HD0229 crr, - HD0227 dnaQ, - HD0223 HD0226 yjjK, - HD0224 ptsI, - HD0228 HD0222 thiP, - HD0230 ptsH, - HD0229 crr, - HD0227 dnaQ, - HD0223 HD0226 yjjK, - HD0224 ptsI, - HD0228 HD0222 thiP, - HD0230 ptsH, - HD0229 crr, - HD0227 dnaQ, - HD0223 HD0226 yjjK, - HD0224 ptsI, - HD0228 HD0222 thiP, - HD0230 thiQ, - HD0231 thiQ, - HD0231
* Calculated from Protein Sequence

Gene ID: HD0227

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
crr  

Definition:
PTS system, glucose-specific IIA component (crr)

Gene Start:
166164

Gene Stop:
165661

Gene Length:
504

Molecular Weight*:
17966

pI*:
4.40

Net Charge*:
-10.51

EC:
2.7.1.69  

Functional Class:
Transport and binding proteins; Carbohydrates, organic alcohols, and acids  

Pathway: pathway table
Aminosugars metabolism
Fructose and mannose metabolism
Galactose metabolism
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism

Secondary Evidence:
De Reuse,H. and Danchin,A.
The ptsH, ptsI, and crr genes of the Escherichia coli
phosphoenolpyruvate-dependent phosphotransferase system: a complex
operon with several modes of transcription
J. Bacteriol. 170 (9), 3827-3837 (1988)
Medline: 88314869

Hall,B.G. and Sharp,P.M.
Molecular population genetics of Escherichia coli: DNA sequence
diversity at the celC, crr, and gutB loci of natural isolates
Mol. Biol. Evol. 9 (4), 654-665 (1992)
Medline: 92334137



Comment:
For other PTS related genes, see HD1859 (ptsII), HD0585 (ptsN), HD0768 (ptnA), HD0766 (ptnD), HD0767 (ptnC).

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to PTS system, glucose-specific IIA component (crr). Residues 1-166 are 77% similar to this protein from Haemophilus influenzae (1172715|) and are 76% similar to this protein from Pasteurella multocida (15602761|).

COGS Summary:  COGS Search
BeTs to 4 clades of COG2190
COG name: Phosphotransferase system IIA components
Functional Class: G
The phylogenetic pattern of COG2190 is --------EB-h--gpo----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001127 (Sugar-specific permease, EIIA 1 domain) with a combined E-value of 3.6e-45.
    IPB001127A    20-54
    IPB001127B    59-101


ProDom Summary:  Protein Domain Search
Residues 36-140 are 79% similar to a (COMPONENT SYSTEM PHOSPHOTRANSFERASE TRANSPORT PTS IIABC) protein domain (PD002243) which is seen in PTGA_HAEIN.



Paralogs:  Local Blast Search
HD0227 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 36 to 140 (E-value = 9.3e-53) place HD0227 in the PTS_EIIA_1 family which is described as phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 (PF00358)

PDB Hit:
pdb|1GGR|A Chain A, Complex Of Enzyme Iiaglc And The Histidine-... 226 2e-060
pdb|1F3G| Phosphocarrier Iiiglcfast >gi|2914331|pdb|1F3Z| ... 222 2e-059
pdb|1AX3| Solution Nmr Structure Of B. Subtilis Iiaglc, 16 S... 119 2e-028

Gene Protein Sequence:
MGFFDKLFGSKQTSANEVNIYAPISGEIVNIEDVPDVVFSEKIVGDGIAI
RPNGDTIVAPVNGTIGKIFETNHAFSIESEEGIDLFVHFGIDTAELKSEG
FTRIAQEGQTVKVGDVIIKFDLELLENKAKSVLTPVLISNMDDISNLVKK
VGNVVAGESVVLTLTKQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTTTTTTCGATAAATTATTCGGCTCAAAACAAACTTCAGCTAACGA
AGTTAACATATATGCTCCTATTTCAGGTGAAATCGTAAACATTGAAGATG
TGCCCGATGTTGTTTTCTCTGAGAAAATTGTAGGCGATGGCATAGCGATC
CGCCCAAATGGTGATACTATTGTAGCTCCAGTAAATGGTACTATCGGAAA
AATTTTTGAAACTAATCACGCTTTTTCAATTGAATCGGAAGAAGGAATTG
ATTTATTCGTCCACTTCGGCATCGATACAGCAGAATTAAAAAGTGAAGGA
TTTACACGCATTGCACAAGAAGGACAAACCGTTAAGGTTGGCGATGTAAT
TATCAAATTCGACTTAGAATTACTTGAAAATAAAGCAAAATCAGTATTAA
CTCCAGTATTAATTTCTAATATGGATGATATCAGCAACCTAGTGAAAAAA
GTTGGAAATGTTGTTGCCGGTGAAAGTGTTGTATTGACCTTAACCAAACA
ATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy