Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Asp-2 IGR148 IGR151 IGR152 IGR154 IGR149 IGR155 IGR153 IGR150 ptsH, - HD0229 crr, - HD0227 clpP, - HD0221 dnaQ, - HD0223 lpxK, - HD0217 clpX, - HD0218 HD0226 yjjK, - HD0224 ptsI, - HD0228 HD0222 ptsH, - HD0229 crr, - HD0227 clpP, - HD0221 dnaQ, - HD0223 lpxK, - HD0217 clpX, - HD0218 HD0226 yjjK, - HD0224 ptsI, - HD0228 HD0222 ptsH, - HD0229 crr, - HD0227 clpP, - HD0221 dnaQ, - HD0223 lpxK, - HD0217 clpX, - HD0218 HD0226 yjjK, - HD0224 ptsI, - HD0228 HD0222
* Calculated from Protein Sequence

Gene ID: HD0224

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
yjjK  

Definition:
ABC transporter, ATP-binding protein

Gene Start:
163968

Gene Stop:
162298

Gene Length:
1671

Molecular Weight*:
62577

pI*:
5.50

Net Charge*:
-11.89

EC:
 

Functional Class:
Transport and binding proteins; ABC Superfamily: ATP-binding protein  

Pathway: pathway table

Comment:
Also contains NBD2.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ABC transporter, ATP-binding protein sequences,e.g.residues 1-556 are 97% similar to ABC transporter,ATP-binding protein in Haemophilus influenzae strain Rd KW20 (1176478|).

Residues 4-556 are 86% similar to ABC transporter, ATP-binding protein in Escherichia coli strain K-12 (2851615|).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0488
COG name: ATPase components of ABC transporters with duplicated ATPase domains
Functional Class: R
The phylogenetic pattern of COG0488 is ----Y--CEBRHuj--olinx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB001140 (ABC transporter transmembrane region) with a combined E-value of 2.9e-23.
    IPB001140A    339-385
    IPB001140B    443-481


ProDom Summary:  Protein Domain Search
Residues 64-161 are 96% similar to a (ATP-BINDING ABC TRANSPORTER PROTEOME) protein domain (PD289355) which is seen in YJJK_HAEIN.

Residues 255-339 are 95% similar to a (ATP-BINDING ABC PROTEOME TRANSPORTER) protein domain (PD005562) which is seen in YJJK_HAEIN.

Residues 392-444 are 98% similar to a (ATP-BINDING ABC TRANSPORTER PROTEOME) protein domain (PD019226) which is seen in YJJK_HAEIN.

Residues 340-387 are 64% similar to a (ATP-BINDING TRANSPORT ABC TRANSPORTER COMPLETE PROTEOME) protein domain (PD000005) which is seen in YJJK_HAEIN.

Residues 491-531 are identical to a (ATP-BINDING ABC TRANSPORTER PROTEOME COMPLETE REPEAT) protein domain (PD000796) which is seen in YJJK_HAEIN.

Residues 445-488 are 65% similar to a (ATP-BINDING TRANSPORT ABC TRANSPORTER COMPLETE PROTEOME) protein domain (PD000006) which is seen in YJJK_ECOLI.

Residues 212-521 are 23% similar to a (ATP-BINDING ABC TRANSPORTER) protein domain (PD068705) which is seen in Q9ZC01_STRCO.



Paralogs:  Local Blast Search
HD0224 is paralogously related to HD1745 (8e-85), HD1768 (3e-60), HD0572 (2e-17), HD1817 (2e-15), HD0860 (2e-14), HD1338 (7e-14), HD1098 (2e-13), HD1019 (5e-13), HD0586 (6e-13), HD2032 (8e-13), HD0811 (1e-12), HD1672 (6e-11), HD1630 (8e-11), HD1651 (1e-10), HD1671 (2e-10), HD1826 (7e-10), HD0259 (7e-10), HD0231 (7e-10), HD0982 (2e-09), HD1820 (3e-09), HD0316 (8e-09), HD1652 (9e-08), HD0863 (6e-07), HD0786 (4e-06), HD1235 (1e-05), HD0315 (3e-05) and HD0984 (2e-04).


Pfam Summary:  Pfam Search
Residues 33 to 236 (E-value = 1.8e-54) place HD0224 in the ABC_tran family which is described as ABC transporter (PF00005)
Residues 350 to 518 (E-value = 2.7e-44) place HD0224 in the ABC_tran family which is described as ABC transporter (PF00005)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSTQFVYTMHRVGKVVPPKRHILKDISLSFFPGAKIGVLGLNGAGKSTLL
RIMAGVDKEFEGEARPQPGIKIGYLPQEPKLEPQQTVREAIEEAVTEVKN
ALTRLDEVYALYADPDADFDKLAAEQANLEAIIQAHDGHNLDNQLERAAD
ALRLPDWDTKIEHLSGGERRRVALCRLLLEKPDMLLLDEPTNHLDAESVA
WLERFLHDYEGTVVAITHDRYFLDNVAGWILELDRGEGIPWEGNYSSWLA
QKEKRLEQEQAAESARQKSIAKELEWVRQNPKGRQAKSKARMARFDELNS
GEYQKRNETNELFIPPGPRLGDKVIEVQHLMKSYGDRTLIDDLSFSIPKG
AIVGIIGANGAGKSTLFRMLSGKEQPDSGSIMLGETVTLASVDQFRDAMD
DKKTVWEEVSNGQDILTIGNFEIPSRAYVGRFNFKGVDQQKRVGELSGGE
RGRLHLAKLLQRGGNVLLLDEPTNDLDVETLRALENAILEFPGCAMVISH
DRWFLDRIATHILDYGDEGKVTFYEGNFSDYEEWKKKTLGDAATQPHRIK
YKRIAK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCACTCAATTCGTATATACGATGCATCGTGTTGGCAAAGTTGTGCC
ACCAAAGCGTCATATTCTTAAAGATATTTCATTAAGCTTTTTCCCCGGTG
CTAAAATTGGGGTACTAGGTTTAAATGGTGCAGGTAAATCCACGCTATTA
CGTATTATGGCTGGCGTAGATAAAGAATTTGAAGGTGAAGCACGCCCACA
ACCCGGTATTAAAATTGGTTATTTACCACAAGAACCAAAACTCGAACCGC
AACAAACTGTCCGTGAAGCGATTGAAGAAGCGGTTACAGAAGTAAAAAAC
GCCTTAACACGTTTAGATGAAGTATATGCTCTCTATGCAGATCCTGATGC
TGATTTTGACAAATTAGCGGCCGAACAAGCAAACTTAGAAGCCATTATTC
AAGCGCACGATGGCCATAACTTAGATAATCAATTAGAACGAGCAGCAGAT
GCCTTACGACTCCCCGATTGGGATACCAAAATTGAACATTTATCAGGCGG
TGAACGCCGTCGTGTCGCATTATGCCGTTTATTGCTTGAAAAACCGGATA
TGTTACTACTAGATGAGCCAACCAACCACTTAGATGCAGAATCTGTTGCT
TGGCTAGAACGGTTCTTACATGACTATGAAGGCACTGTAGTTGCCATTAC
CCACGACCGTTACTTCTTAGACAATGTTGCAGGCTGGATCCTAGAACTTG
ACCGTGGTGAAGGTATTCCTTGGGAAGGCAATTATTCCTCTTGGTTAGCA
CAAAAAGAAAAACGTTTAGAACAAGAACAAGCGGCTGAATCTGCCCGCCA
AAAATCTATTGCGAAAGAATTAGAATGGGTACGCCAAAATCCAAAAGGAA
GACAGGCGAAAAGTAAAGCGCGTATGGCACGTTTTGATGAATTAAATTCA
GGCGAATACCAAAAACGGAATGAAACTAACGAACTGTTTATTCCACCGGG
TCCACGCTTAGGTGATAAAGTGATCGAAGTGCAACACTTAATGAAATCTT
ACGGTGACCGTACCTTAATTGATGATCTCTCGTTTTCAATTCCAAAAGGA
GCTATTGTCGGCATTATCGGTGCTAATGGTGCAGGTAAATCAACACTATT
CCGTATGCTTTCAGGCAAAGAACAACCAGATTCAGGTTCAATTATGTTAG
GTGAAACCGTTACACTCGCTTCTGTAGATCAATTCCGTGATGCAATGGAC
GATAAAAAAACTGTTTGGGAAGAAGTATCAAACGGACAAGATATTCTAAC
CATTGGTAACTTTGAAATTCCAAGCCGTGCATATGTTGGGCGTTTTAACT
TCAAAGGCGTAGATCAACAAAAACGCGTGGGCGAATTATCGGGTGGTGAA
CGCGGTCGATTACATTTAGCCAAATTACTACAACGTGGCGGAAATGTACT
GCTATTAGATGAACCAACCAATGACTTAGACGTTGAAACTTTACGTGCTC
TCGAAAATGCAATTTTAGAATTTCCGGGCTGTGCTATGGTTATCTCGCAC
GATCGTTGGTTCTTAGACCGTATTGCAACGCATATTTTAGACTACGGCGA
TGAAGGCAAAGTCACTTTTTACGAAGGTAACTTCTCTGACTACGAAGAGT
GGAAAAAGAAAACCTTAGGTGATGCAGCAACGCAACCACACCGTATTAAA
TACAAACGTATTGCCAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy