Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Asp-2 IGR148 IGR151 IGR152 IGR154 IGR149 IGR147 IGR153 IGR150 crr, - HD0227 clpP, - HD0221 dnaQ, - HD0223 lpxK, - HD0217 clpX, - HD0218 HD0226 dppA, - HD0215 yjjK, - HD0224 ptsI, - HD0228 HD0222 crr, - HD0227 clpP, - HD0221 dnaQ, - HD0223 lpxK, - HD0217 clpX, - HD0218 HD0226 dppA, - HD0215 yjjK, - HD0224 ptsI, - HD0228 HD0222 crr, - HD0227 clpP, - HD0221 dnaQ, - HD0223 lpxK, - HD0217 clpX, - HD0218 HD0226 dppA, - HD0215 yjjK, - HD0224 ptsI, - HD0228 HD0216 HD0216 HD0222
* Calculated from Protein Sequence

Gene ID: HD0223

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dnaQ  

Definition:
DNA polymerase III, epsilon subunit (dnaQ)

Gene Start:
162225

Gene Stop:
161455

Gene Length:
771

Molecular Weight*:
28702

pI*:
5.30

Net Charge*:
-10.52

EC:
2.7.7.7  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Secondary Evidence:
Cox,E.C. and Horner,D.L.
DNA sequence and coding properties of mutD(dnaQ) a dominant
Escherichia coli mutator gene
J. Mol. Biol. 190 (1), 113-117 (1986)
Medline: 87060973

Maki,H., Horiuchi,T. and Sekiguchi,M.
Structure and expression of the dnaQ mutator and the RNase H genes
of Escherichia coli: overlap of the promoter regions
Proc. Natl. Acad. Sci. U.S.A. 80 (23), 7137-7141 (1983)
Medline: 84070781

Takano,K., Nakabeppu,Y., Maki,H., Horiuchi,T. and Sekiguchi,M.
Structure and function of dnaQ and mutD mutators of Escherichia
coli
Mol. Gen. Genet. 205 (1), 9-13 (1986)
Medline: 87089093

O'Donnell,M.
Accessory protein function in the DNA polymerase III holoenzyme
from E. coli
Bioessays 14 (2), 105-111 (1992)
Medline: 92246902


Comment:
From Genbank:[[gi:1169396]
DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. The epsilon subunit contains the editing function and is a proofreading 3'- 5' exonuclease.


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to DNA polymerase III, epsilon subunit (dnaQ). Residues 8-245 are 62% similar to this enzyme from Haemophilus influenzae (1169396|) and residues 5-244 are 63% similar to this enzyme from Pasteurella multocida (15601971|).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0847
COG name: DNA polymerase III epsilon subunit (3'-5' exonuclease)
Functional Class: L
The phylogenetic pattern of COG0847 is a---YQvcEbRHuj---lINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 92-179 are 67% similar to a (DNA POLYMERASE III EPSILON) protein domain (PD006730) which is seen in Q9KPX9_VIBCH.

Residues 8-91 are 66% similar to a (DNA POLYMERASE III COMPLETE) protein domain (PD002851) which is seen in DP3E_ECOLI.

Residues 93-179 are 80% similar to a (DNA POLYMERASE III DNA-DIRECTED) protein domain (PD380087) which is seen in DP3E_HAEIN.



Paralogs:  Local Blast Search


HD0223 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 176 (E-value = 1e-47) place HD0223 in the Exonuc_X-T family which is described as Exonuclease (PF00929)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSEPQIIRQVVLDTETTGMNFNGPPQIGHNIIEIGAVELINRRLTGRTFH
VYIKPPREVEEEAIKVHGITNAFLQDKPTFAEIAHEFLAFIQGAELIIHN
APFDVAFIDQEFSSLVNPPSKTAEMCTVTDTLQMARKMYPGKRNNLDALC
DRLGIDNSKRVLHGALLDAEILADVFLMMTGGQLALLTEEEHSHTQQQRE
TSLAVKEHFDTSGLIVLQLSQEECQAHQEYLALLDKKSKGNCLWNMLTKA
ESEAKH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGAACCGCAAATAATCCGGCAAGTCGTATTAGATACTGAAACGAC
AGGAATGAATTTTAATGGCCCGCCACAAATTGGGCATAACATTATCGAAA
TAGGCGCAGTAGAACTAATCAATCGCCGTTTAACTGGCCGTACTTTCCAC
GTTTATATAAAGCCGCCCCGCGAAGTTGAAGAAGAAGCAATTAAAGTACA
CGGCATCACTAATGCATTTTTACAAGACAAGCCCACCTTTGCTGAAATTG
CACACGAATTTCTAGCGTTCATTCAAGGTGCAGAATTAATTATTCATAAT
GCGCCCTTCGATGTGGCCTTTATCGATCAAGAATTTTCCTCGCTCGTAAA
TCCACCTAGCAAAACGGCTGAAATGTGTACGGTTACTGACACTTTACAAA
TGGCACGTAAAATGTATCCAGGTAAACGTAATAACTTAGATGCGCTTTGT
GACCGCTTGGGAATTGATAATAGCAAACGTGTACTACATGGTGCTTTACT
CGATGCGGAGATTTTAGCTGATGTTTTTCTAATGATGACAGGTGGACAAC
TAGCATTATTAACGGAAGAAGAACATTCCCATACACAACAACAGCGTGAA
ACATCTCTAGCAGTAAAAGAACATTTTGATACAAGCGGACTAATTGTATT
GCAATTAAGCCAAGAAGAATGTCAAGCACATCAAGAATATTTAGCGCTAC
TCGATAAAAAATCCAAAGGCAATTGTCTTTGGAACATGCTAACAAAAGCA
GAATCTGAAGCTAAACATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy