Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Asp-2 IGR148 IGR146 IGR151 IGR152 IGR149 IGR147 IGR150 clpP, - HD0221 dnaQ, - HD0223 lpxK, - HD0217 clpX, - HD0218 HD0226 dppA, - HD0215 yjjK, - HD0224 HD0222 pdxH, - HD0214 clpP, - HD0221 dnaQ, - HD0223 lpxK, - HD0217 clpX, - HD0218 HD0226 dppA, - HD0215 yjjK, - HD0224 HD0222 pdxH, - HD0214 clpP, - HD0221 dnaQ, - HD0223 lpxK, - HD0217 clpX, - HD0218 HD0226 dppA, - HD0215 yjjK, - HD0224 HD0216 HD0216 HD0222 pdxH, - HD0214
* Calculated from Protein Sequence

Gene ID: HD0221

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
clpP  

Definition:
ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)

Gene Start:
160722

Gene Stop:
160081

Gene Length:
642

Molecular Weight*:
23608

pI*:
6.80

Net Charge*:
-0.37

EC:
3.4.21.92  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Secondary Evidence:
Kroh,H.E. and Simon,L.D.
The ClpP component of Clp protease is the sigma 32-dependent heat
shock protein F21.5
J. Bacteriol. 172 (10), 6026-6034 (1990)
Medline: 91008981

Arribas,J. and Castano,J.G.
A comparative study of the chymotrypsin-like activity of the rat
liver multicatalytic proteinase and the ClpP from Escherichia coli
J. Biol. Chem. 268 (28), 21165-21171 (1993)
Medline: 94012667

Shin,D.H., Lee,C.S., Chung,C.H. and Suh,S.W.
Molecular symmetry of the ClpP component of the ATP-dependent Clp
protease, an Escherichia coli homolog of 20 S proteasome
J. Mol. Biol. 262 (2), 71-76 (1996)
Medline: 96428678

Wang,J., Hartling,J.A. and Flanagan,J.M.
The structure of ClpP at 2.3 A resolution suggests a model for
ATP-dependent proteolysis
Cell 91 (4), 447-456 (1997)
Medline: 98050920

Maurizi,M.R., Clark,W.P., Katayama,Y., Rudikoff,S., Pumphrey,J.,
Bowers,B. and Gottesman,S.
Sequence and structure of Clp P, the proteolytic component of the
ATP-dependent Clp protease of Escherichia coli
J. Biol. Chem. 265 (21), 12536-12545 (1990)
Medline: 90324245



Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to ATP-dependent Clp protease proteolytic subunit. Residues 17-209 are 76% similar to this enzyme from Pasteurella multocida (15603841|) and to Haemophilus influenzae (1168977|)

COGS Summary:  COGS Search
BeTs to 11 clades of COG0740
COG name: Protease subunits of ATP-dependent proteases, ClpP family
Functional Class: O
The phylogenetic pattern of COG0740 is -----qvCebRhuj--OLINx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001907 (Clp protease) with a combined E-value of 2.2e-113.
    IPB001907A    20-44
    IPB001907B    60-105
    IPB001907C    106-144
    IPB001907D    162-205


ProDom Summary:  Protein Domain Search
Residues 20-208 are 76% similar to a (PROTEASE ATP-DEPENDENT PROTEOLYTIC HYDROLASE) protein domain (PD001650) which is seen in Q9CJM2_PASMU.



Paralogs:  Local Blast Search
HD0221 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 28 to 209 (E-value = 4.7e-136) place HD0221 in the CLP_protease family which is described as Clp protease (PF00574)

PDB Hit:
pdb|1TYF|A Chain A, The Structure Of Clpp At 2.3 Angstrom Resol... 294 4e-081
pdb|1TYF|A Chain A, The Structure Of Clpp At 2.3 Angstrom Resol... 359 1e-100

Gene Protein Sequence:
LVELDAFFRIRYKEPKMAVIPMVVEQTSKGERSYDIYSRLLKERIIFLNG
EVEDHMANLIVAQLLFLEAEDPEKDIYLYINSPGGVVTAGLAIYDTMNFI
KPDVATLCTGQACSMGAFLLSGGKKGKRFALPNARVMIHQPLGGARGQAT
DIQIQAQEILKLKEMLTRKMAEHSGQTFAKVAADTERDNFMSATEAKNYG
LIDKVLTSRGEVA$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGTAGAATTGGATGCATTTTTCAGAATTCGATATAAGGAACCCAAAAT
GGCCGTTATTCCTATGGTAGTTGAGCAAACTTCAAAAGGCGAAAGATCAT
ACGATATCTATTCCCGCTTGCTTAAAGAACGCATTATTTTCTTAAATGGC
GAAGTGGAAGATCATATGGCAAACTTAATTGTAGCCCAACTTTTATTCCT
CGAAGCAGAAGATCCAGAGAAAGATATTTATCTTTATATTAATTCACCAG
GCGGTGTGGTAACTGCCGGGCTTGCCATTTACGATACGATGAATTTTATT
AAACCGGATGTTGCGACACTATGCACTGGCCAAGCTTGCTCAATGGGGGC
GTTTTTATTATCGGGTGGGAAAAAAGGGAAACGCTTTGCCTTACCTAATG
CACGGGTAATGATCCATCAACCATTAGGCGGGGCTCGCGGTCAAGCAACA
GATATCCAAATTCAAGCACAAGAAATTTTAAAATTAAAAGAAATGTTAAC
GCGTAAAATGGCAGAACACAGCGGTCAAACTTTTGCTAAAGTTGCTGCAG
ATACAGAACGAGATAATTTTATGTCGGCAACAGAAGCTAAAAATTATGGC
TTAATTGATAAAGTATTAACATCTCGTGGTGAGGTAGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy