Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Asp-2 IGR148 IGR146 IGR145 IGR151 IGR152 IGR149 IGR147 IGR150 clpP, - HD0221 dnaQ, - HD0223 lpxK, - HD0217 clpX, - HD0218 HD0226 dppA, - HD0215 yjjK, - HD0224 HD0222 pdxH, - HD0214 srmB, - HD0213 clpP, - HD0221 dnaQ, - HD0223 lpxK, - HD0217 clpX, - HD0218 HD0226 dppA, - HD0215 yjjK, - HD0224 HD0222 pdxH, - HD0214 srmB, - HD0213 clpP, - HD0221 dnaQ, - HD0223 lpxK, - HD0217 clpX, - HD0218 HD0226 dppA, - HD0215 yjjK, - HD0224 HD0216 HD0216 HD0222 pdxH, - HD0214 srmB, - HD0213
* Calculated from Protein Sequence

Gene ID: HD0218

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
clpX  

Definition:
ATP-dependent Clp protease ATP-binding subunit clpX

Gene Start:
160081

Gene Stop:
158825

Gene Length:
1257

Molecular Weight*:
45936

pI*:
5.90

Net Charge*:
-6.93

EC:
3.4.21.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Secondary Evidence:
Gottesman,S., Clark,W.P., de Crecy-Lagard,V. and Maurizi,M.R.
ClpX, an alternative subunit for the ATP-dependent Clp protease of
Escherichia coli. Sequence and in vivo activities
J. Biol. Chem. 268 (30), 22618-22626 (1993)
Medline: 94043020

Wawrzynow,A., Wojtkowiak,D., Marszalek,J., Banecki,B., Jonsen,M.,
Graves,B., Georgopoulos,C. and Zylicz,M.
The ClpX heat-shock protein of Escherichia coli, the ATP-dependent
substrate specificity component of the ClpP-ClpX protease, is a
novel molecular chaperone
EMBO J. 14 (9), 1867-1877 (1995)
Medline: 95262627


Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ATP-dependent Clp protease protein; e.g. residues 4-417 are 66% similar to (U32754) ATP-dependent Clp protease, ATP-binding subunit of Haemophilus influenzae Rd, residues 8-415 are 63% similar to (L18867) ATP-dependent protease ATPase subunit of Escherichia coli, residues 8-417 are 62% similar to [6225174] ATP-dependent Clp protease protein of Yersinia enterocolitica.

COGS Summary:  COGS Search
BeTs to 12 clades of COG1219
COG name: ATP-dependent protease Clp, ATPase subunit ClpX
Functional Class: O
The phylogenetic pattern of COG1219 is ----yqvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000623 (Shikimate kinase) with a combined E-value of 5.4e-06.
    IPB000623A    118-147
***** IPB001270 (Chaperonins clpA/B) with a combined E-value of 7.9e-06.
    IPB001270E    94-148
    IPB001270G    303-317
    IPB001270H    365-379


ProDom Summary:  Protein Domain Search
Residues 256-304 are 55% similar to a (ATP-BINDING PROTEASE SUBUNIT) protein domain (PD329815) which is seen in CLPX_ECOLI.

Residues 255-304 are 62% similar to a (ATP-DEPENDENT CLPX ATP-BINDING SUBUNIT) protein domain (PD411263) which is seen in CLPX_PASMU.

Residues 63-143 are 71% similar to a (ATP-BINDING PROTEASE SUBUNIT CHAPERONE) protein domain (PD189825) which is seen in CLPX_BUCAI.

Residues 202-304 are 35% similar to a (CHAPERONE MCX1 ATP-BINDING CLPX-LIKE) protein domain (PD259050) which is seen in MCX1_YEAST.

Residues 333-417 are 57% similar to a (ATP-BINDING PROTEASE SUBUNIT) protein domain (PD257346) which is seen in Q9JTX8_NEIMA.

Residues 180-254 are 85% similar to a (ATP-BINDING PROTEASE SUBUNIT) protein domain (PD338319) which is seen in CLPX_PASMU.

Residues 68-387 are 68% similar to a (ATP-BINDING PROTEASE SUBUNIT PROTEOME COMPLETE) protein domain (PD000092) which is seen in Q9I2U0_PSEAE.



Paralogs:  Local Blast Search
HD0218 is paralogously related to HD2007 (4e-21), HD1500 (1e-06), HD0423 (3e-04) and HD1870 (0.001).


Pfam Summary:  Pfam Search
Residues 9 to 45 (E-value = 9.1e-12) place HD0218 in the zf-C4_ClpX family which is described as ClpX C4-type zinc finger (PF06689)
Residues 117 to 326 (E-value = 6.5e-21) place HD0218 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)

PDB Hit:
pdb|1E94|E Chain E, Hslv-Hslu From E.Coli >gi|11513636|pdb|1E94... 95 1e-020
pdb|1DO2|A Chain A, Trigonal Crystal Form Of Heat Shock Locus U... 95 1e-020
pdb|1G3I|A Chain A, Crystal Structure Of The Hsluv Protease-Cha... 90 6e-019

Gene Protein Sequence:
MAFEKEPHCSFCGKRRSEVDQLVEGCEGYICNDCIEESYVLLNGAEEPLI
DDSQNDEKFFENVPTPHQIHAHLDDYVIGQEHAKKVLSVAVYNHYKRLRN
ALSHHQETNGVELGKSNILLIGPTGSGKTLLAETLARRLNVPFAVADATT
LTQAGYVGEDVENVIQKLLMKCNFDAELAERGIIFIDEIDKITRKSESPS
ITRDVSGEGVQQALLKLIEGTVANINPQGSRKHPKGETIAVDTSKILFIC
GGAFAGLDKVVEARTHTQSGIGFAAELKKDKDREDLTSLFKQIEPEDLVK
FGLIPELIGRLPVITPLQELDEAALIAILTKPKNAIITQYQALFKMEGVE
LKFTKDALTAIAQKSIVRKTGARGLRSIVENLLLDTMYDLPTLKNSQGIT
KITVGKGCVQNGDKPKMA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCATTTGAAAAAGAGCCACATTGTAGTTTTTGTGGCAAGCGTAGATC
CGAAGTTGATCAACTGGTAGAAGGCTGTGAAGGGTATATTTGTAACGATT
GTATTGAAGAATCCTACGTATTATTAAATGGCGCAGAGGAGCCATTGATT
GATGATTCACAAAATGATGAAAAATTCTTTGAGAATGTACCCACCCCTCA
TCAAATCCACGCGCATTTAGACGACTATGTAATCGGTCAAGAGCACGCCA
AGAAAGTCTTGTCTGTTGCGGTCTATAATCACTATAAACGCTTACGCAAT
GCGCTTTCTCATCATCAAGAAACCAATGGCGTTGAATTAGGCAAAAGCAA
TATTTTACTGATTGGGCCAACAGGTAGCGGTAAAACATTATTAGCCGAAA
CGCTTGCACGCCGTTTAAACGTTCCTTTTGCAGTGGCGGACGCGACTACT
TTAACGCAAGCAGGTTATGTTGGGGAAGATGTAGAAAACGTTATCCAAAA
ACTACTGATGAAATGCAATTTTGATGCTGAATTAGCGGAACGCGGTATTA
TTTTTATTGATGAAATCGACAAAATAACACGTAAGTCTGAAAGTCCATCT
ATTACACGTGACGTTTCAGGTGAAGGTGTACAACAAGCATTGTTAAAATT
AATTGAAGGAACCGTGGCTAATATTAATCCTCAAGGTAGCCGTAAACATC
CTAAAGGCGAAACCATTGCTGTGGATACATCAAAAATATTGTTTATCTGT
GGTGGCGCCTTTGCAGGCTTAGATAAAGTAGTTGAAGCACGTACTCATAC
TCAAAGTGGCATCGGTTTTGCCGCTGAGTTGAAGAAAGATAAAGATCGGG
AAGATTTAACTTCATTATTCAAACAAATTGAGCCTGAAGATTTAGTGAAA
TTTGGTTTAATTCCAGAATTAATTGGGCGCTTACCGGTGATCACGCCGTT
ACAAGAATTAGATGAAGCAGCATTAATTGCAATCTTAACCAAACCCAAAA
ATGCCATTATTACTCAATATCAAGCGCTTTTCAAAATGGAAGGTGTTGAA
CTCAAATTTACTAAAGATGCTTTAACTGCAATTGCACAAAAATCCATTGT
TCGTAAAACAGGTGCACGTGGCTTACGTTCGATTGTAGAAAATTTATTGT
TGGATACAATGTACGATTTACCAACTTTAAAAAATAGTCAAGGCATTACA
AAAATCACGGTGGGTAAAGGCTGTGTACAGAATGGCGATAAGCCCAAAAT
GGCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy