Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Asp-2 IGR143 IGR148 IGR146 IGR144 IGR145 IGR151 IGR149 IGR147 IGR150 clpP, - HD0221 dnaQ, - HD0223 lpxK, - HD0217 clpX, - HD0218 dppA, - HD0215 yjjK, - HD0224 HD0222 rimI, - HD0212 pdxH, - HD0214 srmB, - HD0213 clpP, - HD0221 dnaQ, - HD0223 lpxK, - HD0217 clpX, - HD0218 dppA, - HD0215 yjjK, - HD0224 HD0222 rimI, - HD0212 pdxH, - HD0214 srmB, - HD0213 clpP, - HD0221 dnaQ, - HD0223 lpxK, - HD0217 clpX, - HD0218 dppA, - HD0215 yjjK, - HD0224 HD0216 HD0216 HD0222 rimI, - HD0212 pdxH, - HD0214 srmB, - HD0213
* Calculated from Protein Sequence

Gene ID: HD0217

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lpxK  

Definition:
tetraacyldisaccharide 4'-kinase

Gene Start:
158795

Gene Stop:
157809

Gene Length:
987

Molecular Weight*:
36963

pI*:
9.90

Net Charge*:
8.25

EC:
2.7.1.130  

Functional Class:
Cell envelope; Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides  

Pathway: pathway table
Lipopolysaccharide biosynthesis

Secondary Evidence:
Hashimoto M, Asai Y, Tamai R, Jinno T, Umatani K, Ogawa T.
Chemical structure and immunobiological activity of lipid A from Prevotella intermedia ATCC 25611 lipopolysaccharide.
FEBS Lett. 2003 May;543(1-3):98-102.
PMID: 12753913

Garrett TA, Que NL, Raetz CR.
Accumulation of a lipid A precursor lacking the 4'-phosphate following inactivation of the Escherichia coli lpxK gene.
J Biol Chem. 1998 May;273(20):12457-65.
PMID: 9575203

Garrett TA, Kadrmas JL, Raetz CR.
Identification of the gene encoding the Escherichia coli lipid A 4'-kinase. Facile phosphorylation of endotoxin analogs with recombinant LpxK.
J Biol Chem. 1997 Aug;272(35):21855-64.
PMID: 9268317

Reddi K, Poole S, Nair S, Meghji S, Henderson B, Wilson M.
Lipid A-associated proteins from periodontopathogenic bacteria induce interleukin-6 production by human gingival fibroblasts and monocytes.
FEMS Immunol Med Microbiol. 1995 Apr;11(2):137-44.
PMID: 7640674

Comment:
From InterPro: IPR003758

Tetraacyldisaccharide-1-P 4'-kinase.

Tetraacyldisaccharide 4'-kinase phosphorylates the 4'-position of a tetraacyldisaccharide 1-phosphate precursor (DS-1-P) of lipid A, but the enzyme has not yet been purified because of instability. This enzyme is involved in the synthesis of lipid A portion of the bacterial lipopolysaccharide layer (LPS).

Blast Summary:  PSI-Blast Search
This sequence corresponds to 33147685 in Genbank.

Its nearest neighbor in the NR database is 32035050 from Actinobacillus pleuropneumoniae serovar 1 str. 4074.


COGS Summary:  COGS Search
BeTs to 5 clades of COG1663
COG name: Lipid A biosynthesis protein LpxK, tetraacyldisaccharide-1-P 4'-kinase
Functional Class: N
The phylogenetic pattern of COG1663 is -----q--e--huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003758 (Tetraacyldisaccharide-1-P 4'-kinase) with a combined E-value of 2.2e-85.
    IPB003758A    20-56
    IPB003758B    68-112
    IPB003758C    117-154
    IPB003758D    158-196
    IPB003758E    231-243
    IPB003758F    282-303
    IPB003758A    22-58


ProDom Summary:  Protein Domain Search
Residues 4-129 are 55% similar to a (COMPLETE PROTEOME KINASE LIPID) protein domain (PD014061) which is seen in Q9CMG8_PASMU.

Residues 280-318 are 58% similar to a (LIPID A 4'-KINASE TETRAACYLDISACCHARIDE) protein domain (PD334053) which is seen in LPXK_ECOLI.

Residues 205-270 are 56% similar to a (TETRAACYLDISACCHARIDE KINASE LIPID) protein domain (PD352108) which is seen in Q9KQX0_VIBCH.

Residues 121-262 are 28% similar to a (PROTEOME COMPLETE ATPASE) protein domain (PD407699) which is seen in O84407_CHLTR.

Residues 141-274 are 61% similar to a (KINASE LIPID TETRAACYLDISACCHARIDE) protein domain (PD225953) which is seen in LPXK_HAEIN.



Paralogs:  Local Blast Search
HD0217 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 324 (E-value = 2.5e-116) place HD0217 in the LpxK family which is described as Tetraacyldisaccharide-1-P 4'-kinase (PF02606)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNIWQKKSIISWLLFPFSCLFWLISQIRWYLFRKNWLKSYRSPVPVLIIG
NISVGGNGKTPLVVWLVEQLQARQINVGVISRGYGGKTTQFPQLVDAQSQ
AEMVGDEPVLIVQRTGVPLAISPNRKQSIELLLSRFPLDLIISDDGLQHY
ALQRNIEWVVIDGERRFGNGFLLPAGSLRELPSRLTSVQAVICNGGTANI
GEHFMKLDATFAQNLLTGEQRPLSHFTQACVAMAGIGYPPRFFNMLRRLG
LQLTQTYSFADHQAFNAVQLATLASHETPLLMTEKDAVKCRHFAQANWWY
VPVNATFSAESTTYLMTEILKYLGKSNE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATATTTGGCAAAAAAAATCCATCATTAGTTGGTTACTTTTTCCATT
CTCTTGTTTATTTTGGTTAATTAGTCAAATTCGTTGGTATTTATTTCGCA
AAAATTGGTTAAAATCCTACCGCTCCCCCGTTCCCGTGTTAATCATTGGC
AATATTTCGGTCGGGGGTAATGGTAAAACGCCTCTCGTCGTTTGGTTAGT
GGAACAATTGCAAGCACGCCAGATCAACGTCGGCGTAATTTCACGTGGTT
ATGGCGGTAAAACGACACAGTTTCCACAACTGGTGGACGCTCAAAGCCAA
GCAGAAATGGTAGGAGACGAGCCGGTCTTAATTGTACAACGAACTGGCGT
TCCGCTTGCTATATCACCTAATCGTAAACAAAGCATTGAGTTATTACTTA
GTCGATTTCCACTTGATTTGATTATTAGTGATGATGGCTTACAACACTAT
GCTTTACAGCGTAACATTGAGTGGGTCGTGATTGATGGCGAACGTCGTTT
CGGTAATGGTTTTCTATTACCCGCAGGCAGTTTACGTGAATTGCCTTCTC
GCTTAACCTCTGTACAAGCGGTGATTTGTAATGGTGGAACGGCTAATATC
GGTGAACATTTCATGAAGCTTGACGCTACTTTTGCCCAAAATCTACTGAC
GGGTGAACAACGCCCGTTAAGCCATTTTACTCAAGCTTGTGTTGCGATGG
CAGGTATTGGTTACCCGCCACGCTTTTTTAATATGTTACGCCGATTAGGT
CTCCAATTAACACAAACATATAGTTTTGCCGATCACCAAGCATTTAACGC
AGTACAATTAGCAACATTAGCATCACACGAAACGCCATTGTTAATGACAG
AAAAAGATGCTGTTAAATGCCGGCATTTTGCTCAAGCAAATTGGTGGTAT
GTCCCCGTTAACGCCACATTTTCAGCAGAATCGACCACTTATTTAATGAC
AGAAATTTTAAAATACTTAGGAAAATCAAATGAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy