Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Asp-2 IGR143 IGR148 IGR146 IGR144 IGR145 IGR151 IGR149 IGR147 IGR142 IGR150 clpP, - HD0221 dnaQ, - HD0223 lpxK, - HD0217 clpX, - HD0218 dppA, - HD0215 yjjK, - HD0224 HD0222 holD, - HD0211 rimI, - HD0212 pdxH, - HD0214 srmB, - HD0213 clpP, - HD0221 dnaQ, - HD0223 lpxK, - HD0217 clpX, - HD0218 dppA, - HD0215 yjjK, - HD0224 HD0222 holD, - HD0211 rimI, - HD0212 pdxH, - HD0214 srmB, - HD0213 clpP, - HD0221 dnaQ, - HD0223 lpxK, - HD0217 clpX, - HD0218 dppA, - HD0215 yjjK, - HD0224 HD0216 HD0216 HD0222 holD, - HD0211 rimI, - HD0212 pdxH, - HD0214 srmB, - HD0213
* Calculated from Protein Sequence

Gene ID: HD0216

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
157816

Gene Stop:
157649

Gene Length:
168

Molecular Weight*:
6103

pI*:
6.50

Net Charge*:
-0.59

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 5-54 are 52% similar to >13473733 hypothetical protein [Mesorhizobium loti] and 52% similar to >23006136 hypothetical protein [Magnetospirillum magnetotacticum].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0216 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 52 (E-value = 5.3e-11) place HD0216 in the DUF343 family which is described as Protein of unknown function (DUF343) (PF03966)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNEALLKTIACPLTHTALEWDKQHNRLISRVAQLAYPIQNGIPVLLPEAA
EKIAD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGAAGCCCTTTTAAAAACCATTGCTTGTCCACTCACACATACTGC
GTTGGAATGGGATAAACAACATAATCGTTTAATCAGCCGAGTAGCACAAT
TAGCTTATCCCATTCAAAATGGTATTCCGGTGTTATTACCTGAAGCCGCT
GAAAAAATAGCGGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy