Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR143 IGR148 IGR146 IGR144 IGR141 IGR145 IGR140 IGR147 IGR142 clpP, - HD0221 HD0207 lpxK, - HD0217 rsmC, - HD0210 clpX, - HD0218 dppA, - HD0215 holD, - HD0211 rimI, - HD0212 pdxH, - HD0214 comF, - HD0209 srmB, - HD0213 clpP, - HD0221 HD0207 lpxK, - HD0217 rsmC, - HD0210 clpX, - HD0218 dppA, - HD0215 holD, - HD0211 rimI, - HD0212 pdxH, - HD0214 comF, - HD0209 srmB, - HD0213 clpP, - HD0221 HD0207 lpxK, - HD0217 rsmC, - HD0210 clpX, - HD0218 dppA, - HD0215 HD0216 HD0216 holD, - HD0211 rimI, - HD0212 pdxH, - HD0214 comF, - HD0209 srmB, - HD0213
* Calculated from Protein Sequence

Gene ID: HD0214

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pdxH  

Definition:
pyridoxamine-5'-phosphate oxidase

Gene Start:
155181

Gene Stop:
155810

Gene Length:
630

Molecular Weight*:
24150

pI*:
9.20

Net Charge*:
4.58

EC:
1.4.3.5  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Pyridoxine  

Pathway: pathway table
Vitamin B6 metabolism

Secondary Evidence:
Mittenhuber G.
Phylogenetic analyses and comparative genomics of vitamin B6 (pyridoxine) and pyridoxal phosphate biosynthesis pathways.
J Mol Microbiol Biotechnol. 2001 Jan;3(1):1-20. Review.
PMID: 11200221

Di Salvo M, Yang E, Zhao G, Winkler ME, Schirch V.
Expression, purification, and characterization of recombinant Escherichia coli pyridoxine 5'-phosphate oxidase.
Protein Expr Purif. 1998 Aug;13(3):349-56.
PMID: 9693059

Lam HM, Winkler ME.
Characterization of the complex pdxH-tyrS operon of Escherichia coli K-12 and pleiotropic phenotypes caused by pdxH insertion mutations.
J Bacteriol. 1992 Oct;174(19):6033-45.
PMID: 1356963



Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to pyridoxamine-5"-phosphate oxidase protein; e.g. residues 1-209 are 64% similar to (U32768) pyridoxamine phosphate oxidase of Haemophilus influenzae Rd, residues 1-209 are 62% similar to (AL162756) pyridoxamine-5"-phosphate oxidase of Neisseria meningitidis, residues 1-209 are 44% similar to [3122599] pyridoxamine 5"-phosphate oxidase of Synechocystis sp.

COGS Summary:  COGS Search
BeTs to 4 clades of COG0259
COG name: Pyridoxamine phosphate oxidase
Functional Class:  H
The phylogenetic pattern of COG0259 is ----y--ce-rh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000659 (Pyridoxamine 5'-phosphate oxidase) with a combined E-value of 6.3e-67.
    IPB000659A    31-51
    IPB000659B    70-113
    IPB000659C    121-147
    IPB000659D    163-192
    IPB000659E    205-209


ProDom Summary:  Protein Domain Search
Residues 23-209 are 65% similar to a (OXIDASE PYRIDOXAMINE 5'-PHOSPHATE) protein domain (PD006312) which is seen in PDXH_HAEIN.



Paralogs:  Local Blast Search

HD0214 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 32 to 117 (E-value = 4.5e-20) place HD0214 in the Pyridox_oxidase family which is described as Pyridoxamine 5'-phosphate oxidase (PF01243)

PDB Hit:
pdb|1G76|A Chain A, X-Ray Structure Of Escherichia Coli Pyridox... 166 3e-042
pdb|1G77|A Chain A, X-Ray Structure Of Escherichia Coli Pyridox... 164 1e-041
pdb|1DNL|A Chain A, X-Ray Structure Of Escherichia Coli Pyridox... 155 4e-039

Gene Protein Sequence:
MDLHNIRADYTKQQLSKKECDANPMKQFERWLNEAIMAKVNEPTAMNMAT
VIDGKPTSRIVLLKEVDQQGFIFFTNYQSCKGWAIALNPYVALTFFWPEL
ERSVRVEGIATKLSEQASDDYFASRPYASRIGAWASDQSQVLSSKRTLVA
KVALLSAKYPLFVPRPAHWGGYLVQPTKIEFWQGRPSWLHDRICYWLVEN
EWLKERLSP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTTACACAATATTCGCGCAGACTACACTAAGCAACAACTTTCAAA
AAAAGAGTGTGATGCAAATCCAATGAAGCAATTTGAGCGGTGGTTAAATG
AAGCGATAATGGCAAAGGTGAATGAACCGACAGCTATGAATATGGCAACC
GTTATAGATGGCAAACCAACCAGTCGTATCGTATTGCTAAAAGAAGTCGA
TCAACAAGGCTTTATTTTCTTCACCAACTATCAAAGCTGTAAAGGATGGG
CAATTGCGTTAAATCCTTATGTCGCATTGACATTCTTTTGGCCAGAGCTA
GAGCGTTCAGTGCGCGTTGAAGGCATTGCGACTAAATTAAGCGAACAAGC
TTCAGATGATTATTTTGCTAGCCGTCCTTATGCTAGTCGTATTGGGGCTT
GGGCGAGCGATCAGAGTCAGGTGTTAAGCAGTAAACGTACATTAGTAGCG
AAAGTTGCCTTATTAAGTGCTAAATATCCTTTGTTTGTGCCACGTCCAGC
ACATTGGGGCGGTTATCTTGTTCAACCAACTAAAATTGAATTTTGGCAAG
GGAGACCAAGTTGGTTGCATGATCGTATTTGTTATTGGTTGGTTGAAAAT
GAATGGCTTAAGGAAAGATTATCGCCGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy