Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR143 IGR137 IGR146 IGR144 IGR141 IGR139 IGR145 IGR138 IGR140 IGR147 IGR142 HD0207 lpxK, - HD0217 rsmC, - HD0210 dppA, - HD0215 rpL27, - HD0205 rpL21, - HD0203 holD, - HD0211 rimI, - HD0212 pdxH, - HD0214 comF, - HD0209 HD0206 srmB, - HD0213 HD0207 lpxK, - HD0217 rsmC, - HD0210 dppA, - HD0215 rpL27, - HD0205 rpL21, - HD0203 holD, - HD0211 rimI, - HD0212 pdxH, - HD0214 comF, - HD0209 HD0206 srmB, - HD0213 HD0207 lpxK, - HD0217 rsmC, - HD0210 dppA, - HD0215 HD0216 HD0216 rpL21, - HD0203 holD, - HD0211 rimI, - HD0212 pdxH, - HD0214 comF, - HD0209 HD0206 srmB, - HD0213 rpL27, - HD0205
* Calculated from Protein Sequence

Gene ID: HD0212

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
rimI  

Definition:
ribosomal-protein-alanine acetyltransferase

Gene Start:
153304

Gene Stop:
153741

Gene Length:
438

Molecular Weight*:
16473

pI*:
5.20

Net Charge*:
-1.82

EC:
2.3.1.-  2.3.1.128  

Functional Class:
Translation; Ribosomal proteins: synthesis and modification  

Pathway: pathway table
Aminosugars metabolism
Benzoate degradation via CoA ligation
Butanoate metabolism
D-Arginine and D-ornithine metabolism
Ethylbenzene degradation
Glycerolipid metabolism
Histidine metabolism
Lipopolysaccharide biosynthesis
Lysine biosynthesis
Lysine degradation
Phenylalanine metabolism
Tyrosine metabolism
Valine, leucine and isoleucine degradation

Secondary Evidence:
Yoshikawa,A., Isono,S., Sheback,A. and Isono,K.
Cloning and nucleotide sequencing of the genes rimI and rimJ which
encode enzymes acetylating ribosomal proteins S18 and S5 of
Escherichia coli K12
Molecular & general genetics : MGG. 209 (3), 481-488 (1987)
Medline: 88121676


Comment:
For the S18 protein (substrate for this enzyme) see HD1047.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ribosomal-protein-alanine acetyltransferase protein; e.g. residues 1-145 are 62% similar to [1172933] ribosomal-protein-alanine acetyltransferase (acetylating enzyme for n-terminal of ribosomal protein S18) of Haemophilus influenzae Rd, residues 2-143 are 54% similar to (AE000507) acyltransferase for 30S ribosomal subunit protein S18; acetylation of N-terminal alanine of Escherichia coli, residues 13-142 are 37% similar to (AE004151) ribosomal-protein-alanine acetyltransferase of Vibrio cholerae.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0456
COG name: Acetyltransferases
Functional Class: R
The phylogenetic pattern of COG0456 is amtkYqvcebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 49-141 are 43% similar to a (COMPLETE PROTEOME TRANSFERASE) protein domain (PD350597) which is seen in Q9JXV2_NEIMB.

Residues 47-124 are 61% similar to a (COMPLETE PROTEOME TRANSFERASE) protein domain (PD339986) which is seen in Q9CM77_PASMU.

Residues 1-42 are 69% similar to a (RIBOSOMAL-PROTEIN-ALANINE TRANSFERASE) protein domain (PD030499) which is seen in RIMI_HAEIN.



Paralogs:  Local Blast Search

HD0212 is paralogously related to HD1841 (0.001).


Pfam Summary:  Pfam Search
Residues 41 to 119 (E-value = 1.7e-18) place HD0212 in the Acetyltransf_1 family which is described as Acetyltransferase (GNAT) family (PF00583)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MIETIVEQDFNRLFEIEQAAHLVPWSKGTLLNNQGAKYLNLKYTEQDNII
AFAICQTLLDEATLFNLAVDPAFQAQGYAKKLLTALINQLQARGISTLWL
EVRQSNTIAQKLYDSVGFNQITIRKNYYPMPDGSRENAVIMALYL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTGAAACTATTGTTGAACAGGATTTTAACCGCTTATTTGAAATTGA
ACAGGCAGCCCACCTAGTGCCGTGGAGTAAAGGCACGTTACTAAATAACC
AAGGCGCTAAATATCTTAATTTAAAATATACCGAACAAGATAACATTATT
GCATTTGCGATCTGCCAAACGCTGTTAGACGAAGCGACCTTGTTTAACTT
AGCGGTTGATCCTGCTTTTCAAGCTCAAGGCTATGCCAAAAAATTATTAA
CTGCGTTAATTAATCAGTTACAAGCGCGTGGTATATCAACGCTTTGGTTA
GAAGTTCGTCAATCCAATACCATCGCACAAAAACTCTATGATTCAGTTGG
CTTTAATCAAATCACGATTCGTAAAAATTATTATCCAATGCCGGATGGTA
GCCGTGAAAATGCGGTCATTATGGCATTGTATTTGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy