Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR143 IGR137 IGR146 IGR144 IGR141 IGR139 IGR145 IGR140 IGR138 IGR142 IGR135 IGR136 slyD, - HD0202 HD0207 rsmC, - HD0210 mrsA, - HD0201 dppA, - HD0215 rpL27, - HD0205 rpL21, - HD0203 holD, - HD0211 rimI, - HD0212 pdxH, - HD0214 comF, - HD0209 HD0206 srmB, - HD0213 slyD, - HD0202 HD0207 rsmC, - HD0210 mrsA, - HD0201 dppA, - HD0215 rpL27, - HD0205 rpL21, - HD0203 holD, - HD0211 rimI, - HD0212 pdxH, - HD0214 comF, - HD0209 HD0206 srmB, - HD0213 HD0207 rsmC, - HD0210 mrsA, - HD0201 dppA, - HD0215 slyD, - HD0202 rpL21, - HD0203 holD, - HD0211 rimI, - HD0212 pdxH, - HD0214 comF, - HD0209 HD0206 srmB, - HD0213 rpL27, - HD0205
* Calculated from Protein Sequence

Gene ID: HD0210

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
rsmC  

Definition:
ribosomal RNA small subunit methyltransferase C

Gene Start:
152712

Gene Stop:
151723

Gene Length:
990

Molecular Weight*:
36844

pI*:
8.10

Net Charge*:
4.89

EC:
2.1.1.52  

Functional Class:
Translation; Ribosomal proteins: synthesis and modification  

Pathway: pathway table

Secondary Evidence:
Tscherne,J.S., Nurse,K., Popienick,P. and Ofengand,J.
Purification, cloning, and characterization of the 16 S RNA m2G1207 methyltransferase from Escherichia coli
J. Biol. Chem. 274 (2), 924-929 (1999)
Medline: 99091632


Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to ribosomal RNA small subunit methyltransferase C. Residues 1-328 are 58% similar to this enzyme from Haemophilus influenzae (1176480|) and residues 2-329 are 45% similar to this enzyme from Yersinia pestis (16120760|).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0500
COG name: SAM-dependent methyltransferases
Functional Class: R
The phylogenetic pattern of COG0500 is AMTKYQVCEBRHUJgPOLINX
Number of proteins in this genome belonging to this COG is 11

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 248-325 are 73% similar to a (METHYLTRANSFERASE RRNA COMPLETE PROTEOME) protein domain (PD009479) which is seen in Q9CM79_PASMU.

Residues 191-247 are 66% similar to a (PROTEOME COMPLETE METHYLTRANSFERASE RRNA) protein domain (PD347933) which is seen in Q9CM79_PASMU.

Residues 189-246 are 58% similar to a (METHYLTRANSFERASE PROTEOME COMPLETE RRNA) protein domain (PD354403) which is seen in RSMC_HAEIN.

Residues 1-182 are 55% similar to a (METHYLTRANSFERASE RRNA PROTEOME) protein domain (PD033675) which is seen in RSMC_HAEIN.



Paralogs:  Local Blast Search
HD0210 is paralogously related to HD1686 (3e-08) and HD0855 (5e-04).


Pfam Summary:  Pfam Search
Residues 86 to 138 (E-value = 3.6e-05) place HD0210 in the MTS family which is described as Methyltransferase small domain (PF05175)
Residues 279 to 329 (E-value = 2.8e-19) place HD0210 in the MTS family which is described as Methyltransferase small domain (PF05175)

PDB Hit:
pdb|1DUS|A Chain A, Mj0882-A Hypothetical Protein From M. Janna... 202 6e-053

Gene Protein Sequence:
MLSLKSEVLARHLPLFNGKSILLFGNVRDRFADQIRSISSHVAIFSHYFD
YARHYNDVEFGLDCTTPANLGVFYWTKNKQECHYQLLQWLSQTAIGQQML
IIGENRAGVRSVEKLLSPFGQIAKIDSARRCGLYHFELQTIPQFDCQKFW
KSYRLADLTVLSLPAAFSSTELDAGSQLLLSSFTNQDRLTGNVLDLGCGA
GVIGAYLKQRFPAISLTMSDIHSMAIHSAQATLAKNKLTGTVIASDVFSH
INDRFDLIVSNPPFHDDIDTAYHTVESLIMQAKNHLNYGGELRIVANAFL
PYPDLLDKAFGSHQVVTKSNKFKVYSARV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCTCTTTAAAAAGTGAAGTCTTGGCTCGCCATTTACCATTATTCAA
TGGCAAGTCAATTTTATTATTTGGCAATGTGCGCGACCGCTTTGCCGATC
AGATTCGATCGATCAGCTCACACGTGGCGATTTTTAGTCATTATTTTGAT
TATGCGCGACACTATAATGATGTTGAATTTGGCTTAGACTGTACTACTCC
TGCCAATCTCGGCGTATTTTACTGGACCAAAAACAAACAAGAATGCCATT
ATCAATTACTGCAATGGCTTTCACAAACTGCCATCGGCCAACAAATGTTA
ATTATCGGCGAAAACCGTGCCGGCGTACGTTCAGTCGAAAAACTATTATC
TCCTTTTGGACAAATTGCTAAAATTGATTCTGCCCGTCGCTGTGGTTTAT
ACCATTTTGAACTACAAACCATTCCCCAATTCGATTGCCAAAAATTTTGG
AAATCCTACCGCTTAGCCGATCTGACTGTATTGAGTTTACCGGCTGCATT
TAGCTCAACTGAATTAGACGCTGGCTCACAACTATTACTCTCTAGCTTCA
CCAATCAAGATCGCCTAACCGGCAACGTGTTAGATCTTGGCTGTGGTGCC
GGTGTTATTGGAGCATATTTGAAACAACGATTCCCCGCTATTTCACTCAC
AATGTCCGATATTCATAGCATGGCTATTCACTCTGCTCAGGCGACCTTAG
CAAAAAATAAACTAACGGGTACAGTGATTGCTAGTGACGTATTCTCACAC
ATTAATGATCGCTTTGATTTAATTGTGTCTAATCCGCCCTTCCACGATGA
CATTGACACTGCTTATCACACGGTTGAATCTCTCATTATGCAAGCGAAAA
ATCACCTTAATTATGGTGGTGAATTACGGATCGTTGCTAATGCCTTTTTG
CCTTATCCAGACTTATTAGACAAGGCATTTGGTTCACATCAAGTCGTCAC
TAAATCAAATAAATTTAAAGTTTATTCTGCTCGCGTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy