Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR137 IGR141 IGR139 IGR140 IGR138 IGR133 IGR134 IGR132 IGR142 IGR135 IGR136 slyD, - HD0202 rpiA, - HD0199 HD0207 rsmC, - HD0210 mrsA, - HD0201 ubiD, - HD0197 rpL27, - HD0205 rpL21, - HD0203 comF, - HD0209 HD0206 znuA,fimA,pzp1, - HD0198 slyD, - HD0202 rpiA, - HD0199 HD0207 rsmC, - HD0210 mrsA, - HD0201 ubiD, - HD0197 rpL27, - HD0205 rpL21, - HD0203 comF, - HD0209 HD0206 znuA,fimA,pzp1, - HD0198 Type: tandem, Name:  - 4 slyD, - HD0202 rpiA, - HD0199 HD0207 rsmC, - HD0210 mrsA, - HD0201 ubiD, - HD0197 rpL21, - HD0203 comF, - HD0209 HD0206 znuA,fimA,pzp1, - HD0198 rpL27, - HD0205
* Calculated from Protein Sequence

Gene ID: HD0202

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
slyD  

Definition:
FKBP-type peptidyl-prolyl cis-trans isomerase slyD (PPiase)

Gene Start:
148097

Gene Stop:
147528

Gene Length:
570

Molecular Weight*:
20754

pI*:
4.50

Net Charge*:
-22.90

EC:
5.2.1.8  

Functional Class:
Translation; Protein modification and translation factors  

Pathway: pathway table

Secondary Evidence:
Roof,W.D., Horne,S.M., Young,K.D. and Young,R.
slyD, a host gene required for phi X174 lysis, is related to the
FK506-binding protein family of peptidyl-prolyl
cis-trans-isomerases
J. Biol. Chem. 269 (4), 2902-2910 (1994)
Medline: 94132064

Hottenrott,S., Schumann,T., Pluckthun,A., Fischer,G. and
Rahfeld,J.U.
The Escherichia coli SlyD is a metal ion-regulated peptidyl-prolyl
cis/trans-isomerase
J. Biol. Chem. 272 (25), 15697-15701 (1997)
Medline: 97332650


Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to peptidyl-prolyl cis-trans isomerase protein; e.g. residues 1-188 are 72% similar to (U32753) peptidyl-prolyl cis-trans isomerase, FkbP-type (rotamase) of Haemophilus influenzae Rd, residues 1-185 are 63% similar to [548939] fkbp-type peptidyl-prolyl cis-trans isomerase slyd (ppiase) (rotamase) (histidine rich protein) of E.coli, residues 1-189 are 60% similar to (AE004327) peptidyl-prolyl cis-trans isomerase, FKBP-type of Vibrio cholerae.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1047
COG name: FKBP-type peptidyl-prolyl cis-trans isomerases 2
Functional Class: O
The phylogenetic pattern of COG1047 is aMtk----E--huj---l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001179 (FKBP-type peptidyl-prolyl cis-trans isomerase (PPIase)) with a combined E-value of 2.5e-07.
    IPB001179    36-69


ProDom Summary:  Protein Domain Search
Residues 3-138 are 86% similar to a (ISOMERASE PEPTIDYL-PROLYL CIS-TRANS) protein domain (PD005561) which is seen in Q9CKP2_PASMU.



Paralogs:  Local Blast Search
HD0202 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKITKNVVPSIAYQVRTQDGVLVDEAPVNQPLEYLHGHNNLVEGLEKALE
EKAVGDVFEVRVKPEEGYGEYNENMVQRVTKDVFMGVDELEVGMRFIADT
DLGPLPVVITAVEGDEVVVDGNHMLAGQELLFSVEVVAIREATEEEIAHG
HIHTDEHGCCGGHGDEEGVCCNEHDKHHNHGSCGCNDHH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATTACAAAAAATGTTGTACCTAGTATCGCTTATCAAGTACGTAC
TCAAGACGGTGTATTAGTCGATGAAGCGCCTGTTAATCAGCCGTTAGAAT
ACCTACACGGCCATAACAATTTGGTAGAGGGCTTAGAAAAAGCACTTGAA
GAAAAAGCGGTTGGTGATGTATTTGAAGTGCGGGTAAAACCAGAAGAAGG
CTACGGTGAATACAACGAAAATATGGTACAACGTGTAACAAAAGATGTAT
TTATGGGCGTGGATGAATTAGAAGTCGGTATGCGTTTTATTGCAGACACT
GATTTAGGTCCTTTACCTGTAGTGATCACCGCAGTAGAAGGCGATGAAGT
GGTCGTTGATGGTAACCATATGTTAGCTGGCCAAGAATTATTATTCTCTG
TTGAAGTTGTGGCTATCCGTGAAGCGACTGAAGAAGAGATTGCACACGGC
CATATTCACACTGATGAACACGGCTGTTGCGGTGGACATGGTGATGAAGA
AGGTGTTTGCTGTAACGAGCACGATAAACATCATAATCATGGTAGCTGTG
GTTGTAACGACCATCACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy