Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR137 IGR130 IGR139 IGR140 IGR138 IGR133 IGR134 IGR132 IGR131 IGR135 IGR136 HD0196 slyD, - HD0202 rpiA, - HD0199 HD0207 mrsA, - HD0201 ubiD, - HD0197 rpL27, - HD0205 rpL21, - HD0203 comF, - HD0209 HD0206 znuA,fimA,pzp1, - HD0198 HD0195 HD0196 slyD, - HD0202 rpiA, - HD0199 HD0207 mrsA, - HD0201 ubiD, - HD0197 rpL27, - HD0205 rpL21, - HD0203 comF, - HD0209 HD0206 znuA,fimA,pzp1, - HD0198 HD0195 Type: tandem, Name:  - 4 HD0196 slyD, - HD0202 rpiA, - HD0199 HD0207 mrsA, - HD0201 ubiD, - HD0197 rpL21, - HD0203 comF, - HD0209 HD0206 znuA,fimA,pzp1, - HD0198 HD0195 rpL27, - HD0205
* Calculated from Protein Sequence

Gene ID: HD0201

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
mrsA  

Definition:
mrsA protein (mrsA)

Gene Start:
147332

Gene Stop:
145998

Gene Length:
1335

Molecular Weight*:
47640

pI*:
5.70

Net Charge*:
-7.75

EC:
5.4.2.2  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table
Aminosugars metabolism
Erythromycin biosynthesis
Galactose metabolism
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Starch and sucrose metabolism
Streptomycin biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to probable phosphorylating protein; e.g. residues 1-442 are 82% similar to [1074789] hypothetical protein (probable phosphorylating protein ureC) of Haemophilus influenzae, residues 3-444 are 71% similar to (AE004149) phosphoglucomutase/phosphomannomutase family protein MrsA in Vibrio cholerae, residues 1-442 are 69% similar to [401561] mrsa proteinof Escherichia coli.

COGS Summary:  COGS Search
BeTs to 16 clades of COG1109
COG name: Phosphomannomutase
Functional Class: G
The phylogenetic pattern of COG1109 is aMTKYQVCEBRHUJgpOLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 143-208 are 60% similar to a (COMPLETE PROTEOME PHOSPHOMANNOMUTASE) protein domain (PD331777) which is seen in MRSA_PSESY.

Residues 215-352 are 45% similar to a (PHOSPHOGLUCOMUTASE COMPLETE PROTEOME ISOMERASE) protein domain (PD344757) which is seen in Q49862_MYCLE.

Residues 357-443 are 57% similar to a (PHOSPHOMANNOMUTASE COMPLETE PROTEOME PHOSPHORYLATION) protein domain (PD001709) which is seen in Q9KU84_VIBCH.

Residues 337-401 are 69% similar to a (PHOSPHORYLATION HOMOLOG PROTEOME COMPLETE) protein domain (PD350136) which is seen in MRSA_HAEIN.

Residues 12-128 are 76% similar to a (PHOSPHOMANNOMUTASE PHOSPHOGLUCOMUTASE ISOMERASE COMPLETE) protein domain (PD000667) which is seen in Q9CNJ0_PASMU.

Residues 144-214 are 87% similar to a (PROTEOME COMPLETE PHOSPHORYLATION MUTASE) protein domain (PD116462) which is seen in MRSA_HAEIN.

Residues 221-335 are 80% similar to a (PHOSPHOMANNOMUTASE COMPLETE PROTEOME ISOMERASE) protein domain (PD000778) which is seen in Q9CNJ0_PASMU.



Paralogs:  Local Blast Search
HD0201 is paralogously related to HD1507 (1e-12).


Pfam Summary:  Pfam Search
Residues 4 to 140 (E-value = 6.9e-64) place HD0201 in the PGM_PMM_I family which is described as Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I (PF02878)
Residues 156 to 256 (E-value = 2.3e-45) place HD0201 in the PGM_PMM_II family which is described as Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II (PF02879)
Residues 258 to 369 (E-value = 7.8e-36) place HD0201 in the PGM_PMM_III family which is described as Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III (PF02880)
Residues 373 to 443 (E-value = 3.1e-12) place HD0201 in the PGM_PMM_IV family which is described as Phosphoglucomutase/phosphomannomutase, C-terminal domain (PF00408)

PDB Hit:
pdb|3PMG|A Chain A, Phosphoglucomutase Mol_id: 1; Molecule: Alp... 63 8e-011

Gene Protein Sequence:
MAERKYFGTDGVRGKVGQFPITPDFALKLGWAAGKILATQGTKQVLIGKD
TRISGYMLESALEAGLAAAGLSAAFVGPMPTPAVAYLTRTFRAEAGIVIS
ASHNPYYDNGIKFFSANGEKLPDEVEEAIEALLDQPMDYVESDQLGKAIR
INDAAGRYIEFCKGTFPADASLKGYKIVVDCAHGATYHIAPNVMRELGAE
VIEIGTHPNGLNINDKCGATDISALQQAVLTSKADLGVAYDGDGDRIIMV
DHLGNKVDGDQILFIIAREALRSGKLKGGVVGTLMSNMGLEIALKHLAIP
FTRANVGDRYVLEQLKEKNWKLGGENSGHIIVLDKNTTGDGIIASLEVLA
AMEAHKMSLNDLTHAVPLFPQVLLNVRFDGGNNPLENAAVKALAKDIETR
LVGKGRILLRKSGTEPLIRVMVECEDAVLAQQYAEEIVSAIQNH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGAACGTAAATATTTTGGCACTGATGGCGTGCGTGGAAAAGTAGG
TCAATTTCCGATTACGCCTGATTTCGCATTAAAGCTAGGTTGGGCAGCGG
GTAAAATTTTAGCAACACAAGGAACCAAGCAAGTATTAATAGGGAAAGAT
ACTCGTATTTCAGGCTATATGTTAGAGTCTGCTTTAGAGGCGGGCTTAGC
TGCTGCGGGTCTTTCTGCTGCGTTTGTTGGGCCAATGCCGACTCCAGCAG
TAGCATATCTGACGCGAACTTTTCGAGCGGAAGCTGGCATTGTTATCTCT
GCATCGCATAATCCATATTATGATAATGGCATAAAATTCTTTTCTGCCAA
TGGTGAAAAATTACCAGACGAAGTCGAAGAAGCTATTGAGGCGTTGTTGG
ATCAACCGATGGACTATGTCGAATCCGATCAATTAGGTAAAGCCATTCGG
ATTAATGATGCTGCTGGTCGTTATATCGAATTCTGCAAAGGCACTTTCCC
TGCTGATGCTAGTTTAAAAGGCTATAAAATAGTAGTCGATTGTGCACACG
GTGCAACTTATCATATTGCGCCGAATGTTATGCGCGAGCTAGGGGCAGAA
GTAATTGAAATCGGCACCCATCCAAATGGTTTGAATATCAATGATAAATG
TGGTGCTACAGATATCAGCGCGTTACAACAAGCTGTTTTAACCTCAAAGG
CTGATCTTGGTGTCGCCTATGATGGTGATGGTGATCGGATTATTATGGTC
GATCATTTAGGCAATAAAGTCGATGGCGATCAAATTCTATTTATCATTGC
TCGTGAGGCATTACGTTCCGGTAAATTGAAAGGCGGTGTGGTCGGCACAT
TAATGAGTAATATGGGATTAGAGATAGCATTGAAGCATTTAGCCATTCCA
TTTACGCGCGCTAATGTAGGTGATCGTTACGTACTAGAACAATTAAAAGA
AAAAAATTGGAAGCTCGGCGGGGAAAATTCCGGACATATCATTGTCTTAG
ACAAAAATACTACGGGGGACGGTATCATTGCTTCATTAGAAGTATTAGCT
GCAATGGAAGCACATAAAATGAGCTTAAATGATTTAACACACGCAGTGCC
ATTATTTCCACAAGTATTATTAAATGTCCGTTTTGATGGTGGTAACAATC
CATTAGAAAACGCAGCCGTGAAAGCTCTTGCTAAAGATATTGAAACGCGT
TTAGTTGGCAAAGGTCGTATTCTGCTACGTAAATCCGGTACAGAACCGCT
AATTCGTGTAATGGTGGAATGTGAAGATGCCGTTTTAGCACAACAATATG
CGGAAGAAATTGTCTCTGCGATACAAAACCATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy