Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR137 IGR130 IGR139 IGR138 IGR133 IGR134 IGR132 IGR131 IGR135 IGR136 IGR129 HD0196 slyD, - HD0202 rpiA, - HD0199 HD0207 mrsA, - HD0201 ubiD, - HD0197 rpL27, - HD0205 rpL21, - HD0203 HD0206 znuA,fimA,pzp1, - HD0198 HD0195 HD0196 slyD, - HD0202 rpiA, - HD0199 HD0207 mrsA, - HD0201 ubiD, - HD0197 rpL27, - HD0205 rpL21, - HD0203 HD0206 znuA,fimA,pzp1, - HD0198 HD0195 Type: tandem, Name:  - 4 HD0196 slyD, - HD0202 rpiA, - HD0199 HD0207 mrsA, - HD0201 ubiD, - HD0197 rpL21, - HD0203 HD0206 znuA,fimA,pzp1, - HD0198 HD0195 rpL27, - HD0205
* Calculated from Protein Sequence

Gene ID: HD0199

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
rpiA  

Definition:
ribose 5-phosphate isomerase A

Gene Start:
145883

Gene Stop:
145224

Gene Length:
660

Molecular Weight*:
23185

pI*:
5.00

Net Charge*:
-4.61

EC:
5.3.1.6  

Functional Class:
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Carbon fixation
Pentose phosphate cycle

Secondary Evidence:
Rangarajan ES, Sivaraman J, Matte A, Cygler M.
Crystal structure of D-ribose-5-phosphate isomerase (RpiA) from Escherichia coli.
Proteins. 2002 Sep 1;48(4):737-40.
PMID: 12211039

Comment:


Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported 6002739 in GenBank.

Matches in gapped BLAST to ribose 5-phosphate isomerase A.
Residues 1-218 are 77% similar to this enzyme from H.influenzae (1173141|) and residues 1-219 are 76% similar to this enzyme from Pasteurella multocida (15603535|).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0120
COG name: Ribose 5-phosphate isomerase
Functional Class: G
The phylogenetic pattern of COG0120 is amtky--ce--h----olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 6-158 are 79% similar to a (ISOMERASE 5-PHOSPHATE RIBOSE) protein domain (PD005813) which is seen in RPIA_HAEIN.

Residues 172-218 are 63% similar to a (ISOMERASE 5-PHOSPHATE RIBOSE) protein domain (PD366044) which is seen in RPIA_HAEIN.



Paralogs:  Local Blast Search
HD0199 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 47 to 216 (E-value = 1.6e-92) place HD0199 in the Rib_5-P_isom_A family which is described as Ribose 5-phosphate isomerase A (phosphoriboisomerase A) (PF06026)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTQQEMKKIAAQAALQFVKPDTIIGVGSGSTVNCFIDALASIKDEIKGAV
AASKASEDQLRAMGIEVFNANEVAGLDVYIDGADEITPQGAMIKGGGAAL
TREKIVSSLAKQFICMVDSSKQVDVLGSSFPLPVEVIPMARSYVARQLVA
LGGSPEYREGVVTDNGNVILDVHNFNIYEPLKMEHTINNIAGVVTNGIFA
QRYANIIIVGTAEGAKIIK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTCAACAAGAAATGAAAAAAATTGCGGCTCAAGCTGCTCTTCAATT
TGTTAAACCAGATACGATAATCGGTGTAGGAAGTGGTTCCACTGTCAATT
GCTTTATTGATGCCCTTGCCTCAATCAAAGATGAGATTAAAGGTGCCGTA
GCGGCCTCTAAAGCATCAGAGGATCAGTTGCGTGCAATGGGTATTGAGGT
GTTTAACGCTAATGAAGTTGCGGGATTAGATGTATATATTGATGGTGCTG
ATGAAATCACGCCACAAGGTGCAATGATAAAAGGTGGCGGCGCAGCATTA
ACGCGTGAAAAAATCGTCAGTTCGCTTGCTAAACAATTTATCTGTATGGT
CGATAGTTCGAAACAAGTTGACGTATTAGGTTCTAGTTTTCCATTGCCGG
TGGAAGTGATCCCGATGGCTCGTTCGTATGTTGCCCGCCAACTAGTTGCC
TTAGGTGGATCACCCGAATATCGCGAAGGTGTTGTTACTGATAATGGCAA
TGTTATTTTAGATGTGCATAATTTTAATATTTATGAACCGCTTAAAATGG
AACACACTATTAATAATATTGCTGGCGTAGTAACCAATGGTATTTTTGCG
CAACGTTATGCCAATATCATCATTGTAGGCACAGCTGAAGGTGCAAAAAT
TATCAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy