Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR130 IGR133 IGR134 IGR132 IGR131 IGR135 IGR136 IGR129 HD0196 slyD, - HD0202 rpiA, - HD0199 mrsA, - HD0201 ubiD, - HD0197 rne, - HD0194 znuA,fimA,pzp1, - HD0198 HD0195 HD0196 slyD, - HD0202 rpiA, - HD0199 mrsA, - HD0201 ubiD, - HD0197 rne, - HD0194 znuA,fimA,pzp1, - HD0198 HD0195 Type: tandem, Name:  - 4 HD0196 slyD, - HD0202 rpiA, - HD0199 mrsA, - HD0201 ubiD, - HD0197 rne, - HD0194 znuA,fimA,pzp1, - HD0198 HD0195
* Calculated from Protein Sequence

Gene ID: HD0197

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ubiD  

Definition:
3-octaprenyl-4-hydroxybenzoate carboxy-lyase (Polyprenyl p-hydroxybenzoate decarboxylase)

Gene Start:
144033

Gene Stop:
142570

Gene Length:
1464

Molecular Weight*:
55245

pI*:
5.90

Net Charge*:
-6.84

EC:
4.1.1.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
Alkaloid biosynthesis I
Aminophosphonate metabolism
Arginine and proline metabolism
Ascorbate and aldarate metabolism
Benzoate degradation via hydroxylation
Flavonoids, stilbene and lignin biosynthesis
Fluorene degradation
Purine metabolism
Pyruvate metabolism
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis
Vitamin B6 metabolism

Primary Evidence:
Lewis,D.A., Klesney-Tait,J., Lumbley,S.R., Ward,C.K., Latimer,J.L.,Ison,C.A. and Hansen,E.J.
Identification of the znuA-encoded periplasmic zinc transport
protein of Haemophilus ducreyi
Infect. Immun. 67 (10), 5060-5068 (1999)
Medline: 99426796


Secondary Evidence:
Leppik,R.A., Young,I.G. and Gibson,F.
Membrane-associated reactions in ubiquinone biosynthesis in
Escherichia coli. 3-Octaprenyl-4-hydroxybenzoate carboxy-lyase
Medline: 76253689

Zhang,H. and Javor,G.T.
Identification of the ubiD gene on the Escherichia coli chromosome
J. Bacteriol. 182 (21), 6243-6246 (2000)
Medline: 20485580




Comment:
From Genbank:[gi:14548314]
This enzyme catalyzes the decarboxylation of 3-octaprenyl-4- hydroxy benzoate to 2-octaprenylphenol.



Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported 14548314 and 6002737 in GenBank.

Residues 1-487 are 82% similar to 14548300 UBID_PASMU 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (Polyprenyl
p-hydroxybenzoate decarboxylase).

Matches in gapped BLAST to 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (Polyprenyl p-hydroxybenzoate decarboxylase). Residues 1-487 are 79% similar to this enzyme from
E.coli (6686350|).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0043
COG name: Uncharacterized ACR, YigC family
Functional Class: S
The phylogenetic pattern of COG0043 is Amtkyq-ceb--uj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002830 (Protein of unknown function DUF117) with a combined E-value of 2.4e-27.
    IPB002830A    227-238
    IPB002830B    282-299
    IPB002830C    443-456


ProDom Summary:  Protein Domain Search
Residues 26-87 are identical to a (COMPLETE PROTEOME SFRB RFAH) protein domain (PD011525) which is seen in Q9RPX1_HAEDU.

Residues 393-453 are 62% similar to a (PROTEOME 4-HYDROXYBENZOATE DECARBOXYLASE) protein domain (PD006384) which is seen in Q9HIX7_THEAC.

Residues 88-377 are identical to a (PROTEOME COMPLETE DECARBOXYLASE) protein domain (PD004684) which is seen in Q9RPX1_HAEDU.

Residues 378-487 are identical to a (PROTEOME COMPLETE VC0309 AF0209) protein domain (PD128156) which is seen in Q9RPX1_HAEDU.

Residues 3-84 are 40% similar to a (SFP-GERKA VDCC YCLC 4-HYDROXYBENZOATE) protein domain (PD128165) which is seen in Q9S4M7_BBBBB.



Paralogs:  Local Blast Search
HD0197 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 10 to 434 (E-value = 8.3e-221) place HD0197 in the UbiD family which is described as 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (PF01977)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKYRDLREFLNLLEQQGELVRVKQEIDPYLEMAEIADRTLRKAGPAILFE
NPKGYQMPVLCNLFGTPKRVALGMGQENTQALRELGKLLAFLKEPEPPKG
FKELLGQLPQWKQILNMPSKTRDNAACQQIVIEGDAVNLYDLPIMHCHEE
DIAPLITWGLTITQGPHKKRQNLGIYRQQLIAKNKLIMRWLSHRGGALDF
QEWKATYPDKPFPVSVAIGADPATILAAVTPIPDTLPEYAFAGLLRGHKT
EVIKSISNQLDVPASAEIVLEGYIDVNETALEGPYGDHTGYYNEQEYFPV
FTVTHITMRKDAIYHSTYTGRPPDEPAVLGEALNEVFIPILQKQFPEIVD
FYLPPEGCSYRLAVVTIKKQYAGHAKRVMMGVWSFLRQFMYTKFVIVCDD
DINARNWKDVIWAITTRCDPSRDTTLIENTPIDYLDFASPIAGLGSKMGI
DATNKWNGETIREWGKPITKNQQVVQHIDELWDQLGL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATACCGAGATTTACGCGAATTCTTAAATTTACTTGAACAACAAGG
TGAGTTAGTCAGAGTAAAACAAGAGATTGATCCTTATTTAGAAATGGCTG
AAATTGCTGATCGCACGCTACGGAAAGCGGGGCCTGCAATTCTGTTTGAA
AATCCAAAAGGTTATCAAATGCCTGTTTTATGTAATTTATTTGGCACCCC
CAAACGTGTGGCACTCGGTATGGGGCAAGAAAATACTCAAGCGTTACGTG
AATTAGGCAAATTACTCGCGTTTTTAAAAGAACCAGAACCACCCAAAGGC
TTTAAAGAGTTGTTAGGGCAACTGCCACAATGGAAACAAATTTTAAATAT
GCCGAGTAAAACTCGAGATAACGCCGCTTGCCAACAAATTGTCATTGAAG
GTGATGCGGTCAATTTATATGATTTACCCATTATGCATTGTCACGAAGAA
GACATTGCACCATTAATTACTTGGGGCCTCACGATTACACAAGGTCCACA
TAAAAAACGGCAAAACCTAGGTATCTACCGCCAACAATTAATCGCCAAAA
ATAAATTAATTATGCGTTGGCTTTCACATCGTGGTGGCGCATTAGATTTT
CAAGAATGGAAAGCTACGTATCCAGATAAACCCTTTCCGGTTTCTGTCGC
TATTGGGGCTGATCCAGCTACTATTTTGGCAGCCGTTACGCCTATTCCTG
ATACATTACCTGAATATGCGTTTGCCGGCTTATTACGCGGTCATAAAACT
GAAGTCATCAAGTCTATCAGTAATCAATTAGACGTGCCTGCCAGTGCAGA
GATTGTTTTAGAAGGCTATATAGATGTAAATGAAACCGCATTAGAAGGTC
CTTATGGCGATCACACCGGCTATTATAACGAACAAGAGTATTTCCCTGTC
TTTACCGTTACACACATTACAATGCGAAAAGACGCCATTTATCATTCAAC
TTACACGGGGCGACCACCTGATGAACCGGCCGTGTTAGGGGAAGCATTAA
ATGAAGTTTTTATCCCCATCTTACAAAAGCAATTCCCAGAAATCGTTGAT
TTTTATTTACCACCTGAAGGGTGTTCTTATCGTTTAGCCGTAGTAACCAT
TAAAAAACAATACGCAGGGCATGCTAAACGTGTAATGATGGGCGTTTGGT
CATTCCTCCGCCAATTTATGTACACTAAATTTGTGATTGTCTGCGATGAT
GATATTAATGCGCGTAATTGGAAAGATGTAATTTGGGCCATCACCACTCG
TTGTGATCCTAGCCGTGACACTACCCTGATTGAAAACACGCCGATTGACT
ATTTAGACTTCGCTTCACCGATTGCAGGCCTAGGTTCAAAAATGGGAATT
GACGCCACAAATAAATGGAATGGCGAAACAATACGCGAATGGGGAAAACC
TATTACAAAAAATCAACAAGTCGTACAACATATTGATGAACTTTGGGATC
AATTAGGTTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy