Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR130 IGR127 IGR128 IGR126 IGR131 IGR125 IGR129 HD0190 HD0192 HD0196 ubiD, - HD0197 dnaK, - HD0189 rne, - HD0194 HD0193 HD0195 pepO, - HD0191 HD0190 HD0192 HD0196 ubiD, - HD0197 dnaK, - HD0189 rne, - HD0194 HD0193 HD0195 pepO, - HD0191 Type: tandem, Name:  - 3 HD0192 HD0196 ubiD, - HD0197 dnaK, - HD0189 rne, - HD0194 HD0190 HD0193 HD0195 pepO, - HD0191
* Calculated from Protein Sequence

Gene ID: HD0194

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
rne  

Definition:
ribonuclease E (rne)

Gene Start:
140392

Gene Stop:
137450

Gene Length:
2943

Molecular Weight*:
111798

pI*:
7.10

Net Charge*:
1.19

EC:
3.1.4.-  

Functional Class:
Transcription; Degradation of RNA  

Pathway: pathway table
Aminosugars metabolism

Secondary Evidence:
Walsh,A.P., Tock,M.R., Mallen,M.H., Kaberdin,V.R., Gabain Av,A. and McDowall,K.J.
Cleavage of poly(A) tails on the 3'-end of RNA by ribonuclease E of Escherichia coli
Nucleic Acids Res. 29 (9), 1864-1871 (2001)
Pubmed: 11328869


Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to ribonuclease E (rne). Residues 1-584 are 78% similar to this protein from Haemophilus influenzae (16272362|) and residues 1-969 are 55% similar to this protein from Pasteurella multocida (15602856|).

COGS Summary:  COGS Search
BeTs to 8 clades of COG1530
COG name: Ribonucleases G and E
Functional Class: J
The phylogenetic pattern of COG1530 is ---k-qvcE-rH------inx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 391-529 are 62% similar to a (RIBONUCLEASE PROTEOME COMPLETE HYDROLASE) protein domain (PD042869) which is seen in Q9CM52_PASMU.

Residues 43-110 are 89% similar to a (RIBOSOMAL COMPLETE PROTEOME RNA-BINDING 30S REPEAT) protein domain (PD000709) which is seen in RNE_HAEIN.

Residues 112-275 are 89% similar to a (PROTEOME COMPLETE RIBONUCLEASE FILAMENT) protein domain (PD346341) which is seen in RNE_HAEIN.

Residues 100-390 are 42% similar to a (PROTEOME COMPLETE RIBONUCLEASE FILAMENT) protein domain (PD297013) which is seen in Q9PLB4_CHLMU.

Residues 2-78 are 39% similar to a (E PROTEOME COMPLETE RNE) protein domain (PD216616) which is seen in Q9ZDR9_RICPR.

Residues 1-42 are 95% similar to a (RIBONUCLEASE PROTEOME COMPLETE HYDROLASE) protein domain (PD383053) which is seen in RNE_HAEIN.

Residues 279-390 are 96% similar to a (RIBONUCLEASE PROTEOME COMPLETE HYDROLASE) protein domain (PD007819) which is seen in Q9CM52_PASMU.



Paralogs:  Local Blast Search

HD0194 is paralogously related to HD1631 (2e-74) and HD1590 (0.001).


Pfam Summary:  Pfam Search
Residues 35 to 119 (E-value = 2e-15) place HD0194 in the S1 family which is described as S1 RNA binding domain (PF00575)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKRMLINATQKEELRVALVDGQRLFDLDIENPGHEQKKSNIYKGKITRVE
PSLEAAFVDYGSERHGFLPLKEISREYFPADYVFNGRPNIKDIIKEGQEV
IVQVNKEERGNKGAALTTFISLAGSYLVLMPNNPRAGGISRRIEGDERLE
LKEALDCLDVPEDVGLIVRTAGVGKSPEELQWDLKVLLHHWSAIKQSAES
RPAPFLIHQESDVIVRAIRDYLRRDIGEILIDNKKIFEKAKNHIRLVRPD
FINRIRLYEGEVPLFSHYQIESQIESAFQREVRLPSGGSIVIDVTEALTA
IDINSSRSTRGGDIEETALNTNLEAADEIARQLRLRDLGGLIVIDFIDMT
PVRHQREVENRIREATRQDRARIQFGRISRFGLLEMSRQRLSPSLSEASS
HVCPRCQGTGKIRDNESIALSILRLVEEEAIKENTAQVHTIVPIQIASYL
LNEKRTAISSIEKRHNVQVVVVPNQNMETPHFSVYRLRENELLPTLSYDL
AKLYEMRSEDSPLYTHQIPSAEENLTTRNEPVITVESVLQSSELNIQPAP
MPTSANQPSLLNRLIAKIKGLFAKTEEKVEAKPKPKTRNQRERRNRRDRS
NRNDRQERKQATPNQTQEDAKPTRQERTEPKKARRQIVEEVAGVQEAQPE
RRVARDQQSTERRQRRDLRKKVRVEPITTEEPAIENTPIQTEVTKPLSVA
KVQNNKVAEPVVTQAPEQPQPQELPTEVNEERNEQRENNRQRRLPRHLRV
SNQRRRENNNPRTESPVAAMPLNAAVASPELASGKIWIKFGTPPSTEQAE
AKPEEKVRFLSVDEMLEQQQTQSKASNTTTENTKEKEISAVAPLGGFVTQ
HSDRDLVKEKNARNQHLVQPHTQVEDEIIEKEIVEETIAKHASPLGDFVP
QHSELDLVQERHERMQKQPTIEAVEPATEQQPNEKESQPTLPISSVDNCA
IDRRLGTFSRVEHTQAGMTSCRCNRNSHDN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAGAATGTTAATTAATGCGACTCAAAAAGAAGAGTTGCGCGTAGC
GCTTGTAGATGGGCAACGTTTATTTGATTTAGATATTGAAAATCCTGGCC
ACGAGCAAAAAAAATCAAATATTTATAAAGGAAAAATTACTCGCGTAGAA
CCAAGCCTTGAAGCAGCTTTTGTTGATTACGGATCTGAACGGCACGGCTT
CCTCCCTTTAAAAGAAATTTCGCGTGAATATTTTCCTGCCGACTATGTAT
TTAATGGACGCCCGAACATCAAAGACATCATCAAAGAAGGCCAAGAAGTT
ATTGTACAAGTCAATAAAGAGGAAAGAGGAAATAAAGGGGCTGCCTTAAC
AACTTTTATTTCACTAGCGGGCAGTTACTTAGTGTTAATGCCTAATAATC
CTCGTGCTGGCGGTATTTCACGCCGTATTGAAGGCGACGAACGTTTAGAA
TTAAAAGAAGCATTAGATTGCCTAGACGTACCAGAAGACGTGGGATTAAT
CGTCCGTACTGCCGGAGTAGGCAAATCACCTGAAGAATTACAATGGGACT
TAAAAGTTTTATTACACCATTGGAGTGCAATTAAACAATCTGCAGAATCT
CGCCCCGCGCCTTTCCTTATTCATCAAGAAAGTGACGTAATTGTACGCGC
CATCCGTGATTACCTCCGCCGAGATATTGGTGAAATTTTAATTGATAATA
AAAAAATCTTTGAAAAAGCCAAAAATCATATCCGCTTAGTACGGCCTGAT
TTTATCAATCGTATCCGCTTATACGAAGGTGAAGTGCCACTGTTTAGCCA
TTACCAAATCGAATCGCAAATTGAATCTGCTTTCCAAAGAGAAGTTCGTT
TACCCTCTGGTGGCTCAATCGTAATTGACGTAACCGAAGCATTAACAGCC
ATTGATATTAACTCCTCACGTTCAACTCGAGGTGGTGATATTGAAGAAAC
AGCGCTCAATACTAACTTAGAAGCCGCCGATGAAATTGCTCGCCAACTCC
GTTTACGCGATTTAGGCGGTCTAATTGTGATTGATTTTATCGATATGACA
CCGGTTCGCCATCAGCGTGAAGTAGAAAATCGTATCCGTGAAGCCACACG
ACAAGATCGTGCTCGTATTCAATTTGGTCGCATCTCCCGTTTTGGCTTAT
TAGAAATGAGCCGCCAACGTTTAAGCCCATCATTGAGTGAAGCATCAAGC
CACGTCTGCCCACGTTGTCAAGGTACAGGTAAAATTCGTGACAATGAATC
AATCGCACTCTCTATTTTGCGCTTAGTTGAAGAAGAAGCCATCAAAGAAA
ATACTGCACAAGTCCATACGATTGTGCCAATCCAAATTGCCTCTTATTTA
CTTAATGAAAAACGGACCGCTATCTCAAGCATTGAGAAACGCCATAATGT
ACAAGTTGTTGTCGTGCCAAATCAAAATATGGAAACCCCTCATTTCAGCG
TCTATCGTTTACGCGAAAATGAACTACTACCTACCTTAAGTTATGATTTA
GCTAAACTGTATGAAATGCGTAGTGAAGATAGCCCGCTCTATACACACCA
AATTCCATCAGCAGAGGAAAACTTAACGACCCGTAATGAACCTGTTATTA
CTGTTGAATCAGTATTACAAAGCTCAGAGTTAAATATTCAACCGGCACCT
ATGCCAACCTCAGCCAATCAACCTTCATTATTAAACCGCTTAATCGCGAA
AATAAAAGGTTTATTCGCTAAAACTGAAGAAAAAGTTGAAGCCAAACCAA
AACCTAAAACACGCAACCAACGAGAACGCCGTAATCGCCGTGATCGCTCA
AATCGTAATGATCGCCAAGAACGTAAACAAGCGACACCAAACCAAACGCA
AGAGGACGCAAAACCTACACGTCAAGAGCGAACCGAACCGAAAAAAGCGC
GTCGTCAAATTGTAGAAGAAGTTGCAGGCGTACAAGAAGCGCAACCTGAA
CGCCGTGTAGCACGCGATCAACAAAGCACAGAGCGTCGACAACGCCGTGA
TTTACGCAAAAAAGTACGTGTAGAACCAATTACAACTGAAGAACCAGCAA
TTGAAAATACGCCAATACAGACCGAAGTGACTAAACCGCTTTCTGTAGCA
AAAGTACAAAATAACAAAGTAGCAGAACCGGTTGTTACGCAAGCGCCAGA
ACAACCACAACCGCAAGAGCTACCAACAGAAGTAAATGAAGAACGCAATG
AACAACGCGAAAACAATCGCCAACGTCGTTTACCTCGCCATTTACGTGTT
AGTAATCAACGCCGTCGTGAAAATAACAATCCGCGCACTGAAAGCCCGGT
TGCGGCCATGCCACTCAATGCCGCGGTTGCTTCGCCTGAACTAGCAAGCG
GTAAAATTTGGATTAAATTTGGTACACCACCATCAACAGAACAAGCGGAA
GCAAAACCCGAAGAAAAAGTACGTTTCCTTTCTGTCGATGAAATGCTAGA
ACAACAGCAAACACAAAGTAAAGCTAGCAATACCACAACAGAAAATACCA
AAGAAAAGGAAATATCCGCTGTTGCACCGCTAGGTGGTTTTGTCACTCAA
CACAGTGATCGTGACTTAGTTAAAGAAAAAAATGCACGTAACCAACACCT
TGTTCAACCGCATACTCAAGTTGAAGACGAGATAATTGAAAAAGAAATAG
TTGAAGAAACGATTGCAAAACATGCTTCACCGTTAGGCGATTTTGTTCCA
CAACATAGTGAACTTGATTTAGTACAAGAAAGGCACGAACGTATGCAAAA
ACAACCCACGATTGAAGCCGTTGAACCCGCTACCGAACAGCAACCAAATG
AAAAAGAAAGCCAACCTACGCTACCAATATCTTCTGTAGATAATTGTGCT
ATTGATCGTCGTTTAGGTACATTCTCACGCGTGGAACATACACAAGCAGG
AATGACTAGCTGCCGCTGTAACAGAAACAGCCACGATAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy