Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR127 IGR123 IGR128 IGR126 IGR125 IGR124 IGR129 HD0190 HD0192 dnaJ, - HD0188 dnaK, - HD0189 rne, - HD0194 HD0193 pepO, - HD0191 ptrA, - HD0187 HD0190 HD0192 dnaJ, - HD0188 dnaK, - HD0189 rne, - HD0194 HD0193 pepO, - HD0191 ptrA, - HD0187 Type: tandem, Name:  - 3 HD0190 HD0192 dnaJ, - HD0188 dnaK, - HD0189 rne, - HD0194 HD0193 pepO, - HD0191 ptrA, - HD0187
* Calculated from Protein Sequence

Gene ID: HD0191

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pepO  

Definition:
metallopeptidase

Gene Start:
134397

Gene Stop:
136568

Gene Length:
2172

Molecular Weight*:
82767

pI*:
9.50

Net Charge*:
11.28

EC:
3.4.24.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Secondary Evidence:
Tynkkynen,S., Buist,G., Kunji,E., Kok,J., Poolman,B., Venema,G. and
Haandrikman,A.
Genetic and biochemical characterization of the oligopeptide transport
system of Lactococcus lactis.
J. Bacteriol. 175 (23), 7523-7532 (1993)
Medline: 94064545.

Chavagnat,F., Meyer,J. and Casey,M.G.
Purification, characterisation, cloning and sequencing of the gene
encoding oligopeptidase PepO from streptococcus thermophilus A. FEMS
Microbiol. Lett. 191 (1), 79-85 (2000)
Medline: 20461169.

Comment:


Blast Summary:  PSI-Blast Search
Best hit is to 21289838|gb|EAA01983.1| ebiP184 [Anopheles gambiae str. PEST]: residues 209-723 are 50% similar to residues 1-515 of this sequence.

Residues 80 to 723 are 35% ( EScore : 1e-116 ) identical to dbj|BAA24495.1| (AB010440) PepO between residues 48 and 689 in [Porphyromonas gingivalis]
Residues 80 to 723 are 36% ( EScore : 1e-113 ) identical to gb|AAF83386.1|AE003904_7 metallopeptidase between residues 61 and 700 in [Xylella fastidiosa]
Residues 80 to 723 are 35% ( EScore : 1e-105 ) identical to emb|CAB08809.1| (Z95398) unknown between residues 15 and 666 in [Mycobacterium leprae]
Residues 80 to 723 are 33% ( EScore : 1e-103 ) identical to pir||C70838 probable zinc metalloproteinase Rv0198c - Mycobacterium tuberculosis between residues 14 and 662 in [Mycobacterium tuberculosis]
Residues 87 to 723 are 31% ( EScore : 7e-85 ) identical to sp|Q07744|PEPO_LACLA NEUTRAL ENDOPEPTIDASE between residues 5 and 627 in [Lactococcus lactis]
Residues 87 to 723 are 29% ( EScore : 3e-84 ) identical to gb|AAD40473.1|AF116532_1 endopeptidase O between residues 5 and 631 in [Streptococcus parasanguinis]
Residues 87 to 723 are 30% ( EScore : 4e-83 ) identical to sp|Q09145|PEPO_LACLC NEUTRAL ENDOPEPTIDASE between residues 5 and 627 in [Lactococcus lactis]
Residues 81 to 723 are 31% ( EScore : 9e-83 ) identical to sp|O52071|PEPO_LACHE NEUTRAL ENDOPEPTIDASE between residues 18 and 647 in [Lactobacillus helveticus]
Residues 87 to 723 are 30% ( EScore : 4e-82 ) identical to gb|AAF67832.1|AF179267_1 endopeptidase PepO2 between residues 5 and 627 in [Lactococcus lactis]
Residues 80 to 700 are 30% ( EScore : 6e-81 ) identical to gb|AAB66079.2| (AF016688) Contains similarity to Pfam domain: PF00099 between residues 177 and 827 in [Caenorhabditis elegans]

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
***** PR00786 (Neprilysin metalloprotease (M13) family signature) with a combined E-value of 3.1e-31.
    PR00786A    510-522
    PR00786B    528-540
    PR00786C    549-565
    PR00786D    620-631


ProDom Summary:  Protein Domain Search
Residues 528-582 are 61% similar to a (ZINC ENDOPEPTIDASE HYDROLASE) protein domain (PD001606) which is seen in ECE2_BOVIN.

Residues 590-665 are 44% similar to a (ZINC ENDOPEPTIDASE METALLOPROTEASE) protein domain (PD241703) which is seen in Q9PFT1_XYLFA.

Residues 329-526 are 38% similar to a (ENDOPEPTIDASE METALLOPROTEASE ZINC HYDROLASE NEUTRAL) protein domain (PD358468) which is seen in O50642_PORGI.

Residues 80-294 are 29% similar to a (ZINC METALLOPROTEASE ENDOPEPTIDASE) protein domain (PD002031) which is seen in Q9PFT1_XYLFA.

Residues 532-590 are 69% similar to a (METALLOPROTEASE ENDOPEPTIDASE ZINC) protein domain (PD415518) which is seen in O06075_MYCLE.

Residues 329-542 are 23% similar to a (CG6265) protein domain (PD314169) which is seen in Q9VB85_DROME.



Paralogs:  Local Blast Search
HD0191 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 85 to 462 (E-value = 5.3e-105) place HD0191 in the Peptidase_M13_N family which is described as Peptidase family M13 (PF05649)
Residues 518 to 720 (E-value = 1.3e-69) place HD0191 in the Peptidase_M13 family which is described as Peptidase family M13 (PF01431)

PDB Hit:
pdb|1DMT|A Chain A, Structure Of Human Neutral Endopeptidase Co... 253 6e-068

Gene Protein Sequence:
MKFYNYFRFLYVISGVILGRFCYLLPKVNYQFLINIRKKQVKKFSKSTML
CRTLIFSAVAGGITACSHQTTYHSTLTEGVDSAVAPQQDFFRYVNGKWLV
NAQIPADRTSWGTLAELADLNEKRSINLLQSVINDPKLANDARAKRLKAL
YQTYTDLDAREQLALTSIKADLDKINAIHTFADLTRYLIDETKEGNDNLI
VWSVFAHLKNSRQNAVYLANSDLGLSNDYFQKDTPENRATLAQYQDYIRQ
ILTIAKVPNPTASAAAIVAYEKEMANTLFTNEEERDMQKRYNPVAMKDLA
NLSQHINLADYLEAVGVNTEEVILWEPRYFQALDKLINPQKLAVIKDYLL
FKTLSENAGYLHKKLDDMKFAFYGKKLVGQKQQRPLDKRALGIVNSWLGQ
EFAQFYVEKFFPQTAKNDLLEMADYLIKAYHRRIEKLDWMSPETKKKASE
KLDKFIVEVGFPNKWRDYSALQLKTVSEGGTLYDNMRAVAKWAYQENLTK
IGKPVDLNEWGMLPQIVNASYNPLMNRIVFPAGILQAPLYDVYADPAVNF
GAIGAIIGHEITHGFDDSGSKFDGEGNLKDWWTSDDRKKFEALADRLVAQ
FNQFEVAPKVYVNGRFTLGENIADLGGLSIAYDALKLYEQDHGITPMIEN
LSSDQRFFMSWTRSWRHKATVQALTHQVKSDPHAPGQFRAYAPILNISGF
HRAFNTKLGDKMYRNDAERIRIW$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTTTATAACTATTTTCGTTTTTTATATGTTATAAGCGGTGTAAT
TTTAGGCAGATTTTGCTATCTTTTGCCGAAAGTAAACTATCAATTTTTAA
TAAATATAAGGAAAAAACAAGTGAAAAAATTTTCAAAATCTACAATGTTA
TGTAGAACATTAATATTTTCAGCGGTCGCAGGCGGTATAACTGCGTGTAG
CCATCAGACGACTTATCATAGTACCTTGACTGAAGGTGTGGATAGCGCTG
TTGCTCCTCAGCAAGATTTCTTTCGCTATGTGAATGGTAAATGGTTAGTA
AATGCACAAATTCCAGCCGATCGTACTTCATGGGGAACTTTAGCAGAATT
AGCGGATTTAAATGAAAAGCGCTCAATTAATTTATTACAATCGGTCATCA
ATGATCCGAAATTAGCCAATGATGCGCGTGCAAAGCGATTAAAAGCACTT
TATCAAACATATACCGATTTAGATGCGCGTGAACAACTTGCGTTAACGTC
AATAAAAGCCGATTTAGATAAAATTAATGCTATTCATACGTTTGCAGATT
TAACGCGCTATTTAATTGATGAAACGAAAGAGGGAAATGATAATTTAATA
GTTTGGTCAGTTTTTGCACATTTAAAAAATTCACGTCAGAACGCGGTTTA
TTTAGCAAATAGTGATTTAGGGCTAAGTAATGATTATTTTCAGAAAGATA
CGCCAGAAAATCGGGCGACTTTAGCGCAATATCAGGATTACATTCGTCAG
ATTTTAACTATTGCCAAGGTGCCAAATCCAACCGCAAGTGCTGCAGCTAT
TGTGGCGTATGAAAAAGAAATGGCGAATACATTGTTTACTAACGAAGAAG
AGCGGGATATGCAAAAACGCTATAATCCTGTGGCAATGAAAGATTTAGCC
AACTTGAGTCAACATATTAATTTAGCTGATTATTTAGAAGCCGTGGGGGT
AAATACAGAAGAAGTCATTTTATGGGAGCCACGTTATTTCCAAGCATTAG
ATAAATTAATCAATCCACAAAAATTAGCGGTCATTAAAGATTATCTGTTA
TTTAAAACACTTTCTGAAAATGCGGGTTATTTGCATAAAAAGCTAGATGA
TATGAAGTTTGCGTTTTATGGTAAAAAATTGGTTGGTCAAAAGCAACAAC
GTCCATTAGATAAACGGGCATTAGGGATCGTGAATAGTTGGTTAGGGCAA
GAGTTTGCACAATTTTATGTAGAAAAATTCTTTCCGCAAACAGCTAAAAA
TGATCTACTAGAAATGGCGGATTACTTGATTAAGGCTTACCATCGTCGTA
TTGAAAAATTGGATTGGATGTCGCCGGAAACGAAGAAAAAAGCAAGTGAG
AAATTAGATAAATTTATTGTTGAAGTGGGTTTCCCAAATAAATGGCGTGA
TTATTCCGCTTTGCAACTTAAAACGGTCAGTGAAGGTGGAACCTTGTACG
ATAATATGCGGGCTGTAGCAAAATGGGCCTATCAAGAGAATTTAACAAAA
ATAGGTAAGCCAGTTGATTTAAATGAATGGGGAATGTTACCTCAAATCGT
CAATGCTTCTTACAATCCATTGATGAATAGAATTGTATTTCCTGCCGGTA
TTTTACAAGCGCCACTTTATGATGTTTATGCTGATCCGGCAGTTAATTTT
GGTGCGATTGGTGCAATTATTGGCCATGAAATTACGCACGGATTTGATGA
TAGCGGTTCTAAATTTGATGGCGAGGGCAATCTAAAGGATTGGTGGACTT
CGGATGATCGTAAAAAGTTTGAAGCATTAGCGGATCGATTAGTCGCACAA
TTTAATCAATTTGAAGTTGCACCAAAAGTGTATGTAAATGGGCGCTTCAC
GCTAGGTGAAAATATTGCTGATTTGGGCGGTTTAAGTATTGCGTATGATG
CATTAAAATTGTACGAACAAGATCACGGTATTACACCAATGATTGAGAAT
CTAAGCAGTGATCAGCGTTTCTTTATGAGCTGGACACGTTCTTGGCGGCA
TAAAGCTACAGTACAGGCACTGACTCACCAAGTGAAAAGTGATCCTCACG
CACCGGGTCAATTCCGTGCTTATGCACCAATCTTAAATATTAGTGGGTTC
CATCGAGCATTTAATACAAAATTGGGTGATAAAATGTATCGAAATGATGC
GGAACGAATTCGTATTTGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy