Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR122 IGR123 IGR125 IGR124 dnaJ, - HD0188 dnaK, - HD0189 HD0185 recC, - HD0186 dnaJ, - HD0188 dnaK, - HD0189 HD0185 recC, - HD0186 dnaJ, - HD0188 dnaK, - HD0189 HD0185 recC, - HD0186 ptrA, - HD0187 ptrA, - HD0187
* Calculated from Protein Sequence

Gene ID: HD0187

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ptrA  

Definition:
protease III precursor

Gene Start:
127873

Gene Stop:
130827

Gene Length:
2955

Molecular Weight*:
111267

pI*:
6.80

Net Charge*:
-2.37

EC:
3.4.24.55  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Secondary Evidence:
Finch,P.W., Wilson,R.E., Brown,K., Hickson,I.D. and Emmerson,P.T.
Complete nucleotide sequence of the Escherichia coli ptr gene
encoding protease III
Nucleic Acids Res. 14 (19), 7695-7703 (1986)
Medline: 87040734

Claverie-Martin,F., Diaz-Torres,M.R. and Kushner,S.R.
Analysis of the regulatory region of the protease III (ptr) gene of Escherichia coli K-12
Gene 54 (2-3), 185-195 (1987)
Medline: 88005781

Becker,A.B. and Roth,R.A.
Identification of glutamate-169 as the third zinc-binding residue
in proteinase III, a member of the family of insulin-degrading
enzymes
Biochem. J. 292 (Pt 1), 137-142 (1993)
Medline: 93277449



Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to protease III precursors.Residues 51-952 are 40% similar to this enzyme from Yersinia pestis (16121320|) and residues 51-977 are 37% similar to this enzyme from E.coli (131573|).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1025
COG name: Secreted/periplasmic Zn-dependent peptidases, insulinase-like
Functional Class: O
The phylogenetic pattern of COG1025 is ----Y---e---------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 106-199 are 59% similar to a (PROTEASE METALLOPROTEASE ZINC HYDROLASE MITOCHONDRIAL) protein domain (PD000718) which is seen in PTRA_ECOLI.

Residues 433-548 are 37% similar to a (HYDROLASE CONVERTASE METALLOPROTEASE ZINC) protein domain (PD286559) which is seen in PTRA_ECOLI.

Residues 813-947 are 28% similar to a (HYDROLASE CONVERTASE ZINC METALLOPROTEASE) protein domain (PD003953) which is seen in ST23_YEAST.

Residues 209-289 are 49% similar to a (PROTEASE METALLOPROTEASE ZINC COMPLETE PROTEOME) protein domain (PD129062) which is seen in PTRA_ECOLI.

Residues 51-101 are 58% similar to a (ZINC METALLOPROTEASE HYDROLASE INSULINASE) protein domain (PD037445) which is seen in PTRA_ECOLI.

Residues 300-424 are 41% similar to a (HYDROLASE ZINC METALLOPROTEASE CONVERTASE) protein domain (PD129067) which is seen in PTRA_ECOLI.

Residues 874-977 are 31% similar to a (PROTEASE III PERIPLASMIC MAGNESIUM) protein domain (PD129059) which is seen in PTRA_ECOLI.

Residues 548-719 are 31% similar to a (PROTEASE III PERIPLASMIC MAGNESIUM) protein domain (PD292545) which is seen in PTRA_ECOLI.



Paralogs:  Local Blast Search
HD0187 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 75 to 213 (E-value = 9e-41) place HD0187 in the Peptidase_M16 family which is described as Insulinase (Peptidase family M16) (PF00675)
Residues 234 to 418 (E-value = 1.3e-20) place HD0187 in the Peptidase_M16_C family which is described as Peptidase M16 inactive domain (PF05193)
Residues 704 to 883 (E-value = 2.5e-09) place HD0187 in the Peptidase_M16_C family which is described as Peptidase M16 inactive domain (PF05193)

PDB Hit:
pdb|1BCC|A Chain A, Cytochrome Bc1 Complex From Chicken >gi|582... 65 5e-011

Gene Protein Sequence:
MKKNFIAQSVRYALCSYFTLAVMNPTFANDLPNQTANSVQTMPNMADFAF
IKQTINKSPNDTAIYQAIELANGMTVLLISDEKANKSLMSLALPIGSMED
PIEQQGLAHYLEHMILMGSKAYPETNSLDKFLNKNGGYNNASTSPDRTAY
YLEVNNDAFAEAVTRLADTFAQPLLSESNGKKEVNAVNAEMIRAKSNDGH
LIQSVNLATANPAHPITKFTVGNNETLSDKPNSKLHTELEKFYHTHYSAN
LVKAVLYSNQSIEQLATLAAKTLGKMQNKNLSVPTVEEPFFRPTDKGVWI
EYKPVKPTKLLSISFDMQNDEAKFANKTGEYLAYVLNNHTAGTLSDYLIK
QGLSDSGIAAGASPNVSRNRGSFTIYIDLTDKGLAHKDHIISLVFQQLEQ
IKKDGIQESYFNEVRESLKQDFQHLQVEKDGYYIEALAEQMLHYPIEHIL
DAEYLVDKMDVEAIKAKLNEMTLDNARIILVSEQAKTDKKTPYFEAGYSI
AKFTDVQKAKWLDFSHNPSLKLPALNPYFATDFSLIKPTDERKFPKVIES
DKGKVIYAMPSQYFANDPKARISINFSIMPKEDDLKQYISATLLGYMNNL
AQNELDFQSSVAGMQTSLDISANGIAINVSGYTQHLAKLVQDTLTKFKQF
KLTEEFLAQAKERVLEALARKNKANSLEQTNRILSNFADYPYFEEDKQRK
VINEITLADIKAIREKVLSKPTGVNVLSVGNLDDSQVKQLVQHVNEVVQN
RNLELGKARYLDLNESERKFNYVQTVPHEDNALNVTYLAKGYDELDSSIR
SRLLSDIISRWYFDDLRTQKQLGYVVYATNVQMGKTSGLRFMVQSPNTTP
AGIMQHNMRFFKESADKLNALTDEEFKRYQTSLVEKLARKPESLVQEFSL
FMFDFYRKNNQFDHLAKSIATVKKLTKQDIIEFYQRAVIEQKGLSFISQA
LGTKATAADGVILQDYQKIESIEALQKEFSVKFY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAGAATTTTATTGCACAATCAGTCCGTTATGCGCTCTGTTCTTA
TTTCACATTAGCAGTGATGAACCCAACATTTGCTAATGATTTACCAAATC
AGACCGCTAATTCAGTACAAACAATGCCAAATATGGCTGATTTTGCTTTT
ATTAAGCAAACTATAAATAAGAGCCCAAATGATACCGCAATTTATCAAGC
GATTGAGCTTGCTAATGGTATGACGGTTCTATTAATTTCTGACGAAAAAG
CGAATAAATCACTGATGTCGCTTGCTTTACCTATTGGTTCAATGGAAGAT
CCAATCGAACAGCAAGGCCTAGCGCATTATTTAGAACATATGATCTTGAT
GGGATCAAAAGCCTATCCCGAAACGAATAGTTTAGATAAATTTTTAAATA
AAAATGGTGGCTATAATAATGCATCTACCTCGCCTGATCGCACGGCATAT
TATCTAGAAGTAAATAATGATGCTTTTGCTGAAGCAGTAACAAGATTAGC
AGATACGTTTGCACAACCGCTTTTATCAGAAAGTAATGGTAAAAAAGAAG
TTAATGCCGTTAATGCTGAAATGATCCGCGCTAAATCAAATGATGGGCAT
TTAATCCAAAGTGTTAATTTAGCTACAGCTAATCCTGCGCATCCAATCAC
GAAATTTACGGTGGGTAATAACGAAACCCTATCAGATAAACCAAACAGTA
AACTACATACTGAATTAGAGAAGTTTTATCACACTCATTATTCTGCCAAC
TTAGTGAAAGCGGTGCTTTATTCAAATCAATCTATTGAGCAATTAGCAAC
ATTAGCGGCTAAAACGTTAGGGAAAATGCAAAATAAAAATTTGAGTGTGC
CTACCGTTGAAGAGCCTTTTTTCCGCCCAACAGATAAAGGTGTGTGGATT
GAGTATAAGCCCGTTAAGCCGACAAAATTATTGAGTATTTCTTTTGATAT
GCAAAATGATGAAGCGAAATTTGCGAATAAAACCGGTGAGTATTTAGCCT
ATGTACTCAATAATCACACGGCAGGAACCTTATCGGATTATTTGATCAAA
CAAGGTCTGTCAGACAGTGGCATTGCGGCAGGTGCTAGTCCAAATGTAAG
TCGTAATCGTGGTAGCTTCACGATTTATATAGATTTAACGGATAAAGGTC
TAGCCCACAAAGATCACATCATTTCACTTGTTTTTCAACAACTTGAACAG
ATAAAAAAAGACGGTATTCAAGAGAGTTATTTCAATGAAGTGAGGGAAAG
TTTAAAACAGGATTTTCAACACTTACAAGTAGAAAAAGATGGTTATTATA
TTGAAGCATTAGCGGAGCAAATGCTACATTATCCGATTGAACATATTTTA
GACGCAGAATATCTGGTTGATAAAATGGATGTTGAGGCAATCAAAGCCAA
ATTAAATGAAATGACATTGGATAATGCACGTATTATTTTAGTTTCTGAAC
AGGCTAAAACGGATAAAAAAACGCCTTACTTTGAAGCGGGCTATTCTATT
GCCAAATTTACAGATGTTCAAAAAGCGAAATGGTTGGATTTCAGTCACAA
TCCTAGCTTGAAGTTGCCGGCATTAAATCCATATTTTGCCACGGATTTTA
GTTTGATTAAGCCAACAGATGAACGTAAATTCCCTAAAGTAATTGAATCG
GATAAAGGCAAAGTGATTTATGCAATGCCAAGTCAATATTTTGCTAATGA
TCCTAAAGCGCGTATTTCAATTAATTTTTCGATTATGCCAAAAGAGGATG
ACTTAAAGCAATATATCAGTGCCACCTTACTTGGTTATATGAATAACTTG
GCACAAAACGAACTTGATTTTCAATCTTCCGTAGCCGGTATGCAAACTAG
TTTAGACATTTCGGCAAATGGGATCGCGATCAATGTCAGTGGTTATACGC
AACATTTAGCAAAATTAGTGCAGGATACTTTAACTAAATTCAAACAGTTT
AAATTGACAGAAGAATTCCTCGCCCAAGCGAAAGAAAGAGTACTTGAAGC
ATTGGCACGTAAAAATAAAGCCAATAGTTTAGAACAAACGAATCGTATCC
TATCAAATTTTGCTGATTATCCTTATTTTGAAGAAGATAAACAGCGTAAA
GTGATTAATGAGATTACTTTAGCAGATATTAAAGCGATACGTGAAAAAGT
ATTGAGTAAACCAACCGGTGTAAATGTGTTATCTGTGGGGAATTTAGATG
ATTCACAGGTTAAACAACTTGTGCAACACGTGAATGAAGTGGTACAGAAT
CGCAATCTTGAGTTAGGTAAAGCACGTTATCTTGATTTAAATGAGAGCGA
GCGCAAGTTTAATTATGTACAAACCGTCCCTCATGAGGATAATGCGTTAA
ATGTAACTTATTTAGCTAAAGGCTATGATGAGTTAGATAGTTCTATCCGA
TCGCGGTTATTAAGTGATATTATTAGCCGTTGGTATTTTGATGATTTACG
AACGCAGAAACAGCTTGGCTATGTTGTTTATGCAACGAATGTACAAATGG
GTAAAACATCCGGTTTACGTTTTATGGTACAAAGTCCAAACACCACGCCA
GCAGGTATTATGCAACATAATATGCGTTTCTTTAAAGAATCGGCGGATAA
ATTGAATGCTTTAACTGATGAAGAATTCAAACGTTATCAAACAAGTTTAG
TTGAAAAACTAGCACGTAAGCCCGAATCTTTAGTGCAAGAGTTTTCGCTA
TTTATGTTTGATTTTTACCGCAAAAATAATCAATTTGACCACCTTGCGAA
AAGTATTGCTACTGTTAAAAAATTAACGAAACAAGATATTATTGAATTTT
ATCAGCGGGCTGTTATTGAACAGAAAGGATTGTCATTTATTAGCCAAGCA
TTAGGCACAAAAGCAACTGCAGCAGACGGCGTAATATTGCAAGACTATCA
GAAAATAGAAAGTATTGAAGCATTACAAAAAGAATTCTCAGTTAAATTTT
ACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy