Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR121 IGR119 IGR122 IGR120 IGR123 dnaJ, - HD0188 HD0185 fabA, - HD0181 HD0183 lonB, - HD0179 recC, - HD0186 dnaJ, - HD0188 HD0185 fabA, - HD0181 HD0183 lonB, - HD0179 recC, - HD0186 dnaJ, - HD0188 fabA, - HD0181 recC, - HD0186 HD0180 HD0182 HD0184 ptrA, - HD0187 ptrA, - HD0187 HD0185 HD0183 lonB, - HD0179 HD0180 HD0182 HD0184
* Calculated from Protein Sequence

Gene ID: HD0186

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
recC  

Definition:
exodeoxyribonuclease V gamma chain

Gene Start:
124535

Gene Stop:
127876

Gene Length:
3342

Molecular Weight*:
130605

pI*:
5.10

Net Charge*:
-31.09

EC:
3.1.11.5  

Functional Class:
Replication; Degradation of DNA  

Pathway: pathway table

Secondary Evidence:
Finch,P.W., Wilson,R.E., Brown,K., Hickson,I.D., Tomkinson,A.E. and Emmerson,P.T.
Complete nucleotide sequence of the Escherichia coli recC gene and
of the thyA-recC intergenic region
Nucleic Acids Res. 14 (11), 4437-4451 (1986)
Medline: 86232583


Comment:
From Genbank:[gi:119669]
This enzyme exhibits a wide variety of catalytic activities including ATP-dependent exonuclease, ATP-stimulated endonuclease, ATP-dependent helicase and DNA-dependent ATPase activities.


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to exodeoxyribonuclease V, gamma chain. Residues 1-1027 are 40% similar to this enzyme from Haemophilus influenzae Rd (1169573|) and residues 1-979 are 34% similar to this enzyme from E.coli (119669|).

COGS Summary:  COGS Search
BeTs to 4 clades of COG1330
COG name: Exonuclease V gamma subunit, RecC
Functional Class: L
The phylogenetic pattern of COG1330 is --------e-rh----o-in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 395-744 are 50% similar to a (V EXODEOXYRIBONUCLEASE PROTEOME GAMMA) protein domain (PD025681) which is seen in Q9CM76_PASMU.

Residues 781-905 are 35% similar to a (V EXODEOXYRIBONUCLEASE PROTEOME GAMMA) protein domain (PD329281) which is seen in EX5C_HAEIN.

Residues 28-196 are 23% similar to a (COMPLETE ORF MITOCHONDRION PROTEOME) protein domain (PD000146) which is seen in EX5C_BUCAI.

Residues 301-394 are 44% similar to a (V EXODEOXYRIBONUCLEASE PROTEOME COMPLETE) protein domain (PD148860) which is seen in EX5C_HAEIN.



Paralogs:  Local Blast Search

HD0186 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MFTVYFSQKLSSLAKLFIQLQQSNPNPNPFEAEIVLVQSVGMAQWLQMQI
ANQIGIAGNYEFPFPTSFLWQQYRVLFPELPTENIFERETVTWRLIRLIP
DYLSLPEFQSLQHYLTKDSRQYQLKLYQLAKKVADLFDQYLVYRPHWLVH
WENDRLEIVRDEILNHANLKVKNSEDIWQNLSWQAILWRALINDIKLDCD
ESVFVTSHRAYLQEQYFNKLDNLTEIEKSKLPKRVFIFGISSLPATQLAV
LKKLSEHCQIHLFFLNPSAEYWGDNVEDRVLEKLALKQKMTAKELEALFV
QKNNQLLSMWGKQGRDFLAQILEQEPDQILDVFDACEGDSNLIKLKNAIL
SFDNPQQLLLASQDDSVQFHSCHSIMREVEVLHNRLLQMFAQDPTLAAKD
IIVMSADINQYAPYIEAVFSRYMKEDKRYIPFAFADQKAITVDPILMSFM
SLLNLKESLFDAESLLDLLDVNAIRERFQFQLQDIHIVRHWVNQAGIRFG
LTIDQSEWQNYNAWQNGLTRLLMGISLREENGIWQDSVAFNESYGLSAEL
VGYLANFIEKLSAWHQIIQQKQPIEVWQKQLSLLINDFYQENEESVHAIN
LLNIALAEIIQKITDAKFEQQIDIEIISLLFNEKLNSQQNNLNFLVGKVN
FCTLLPMRAIPFKVVCLLGMNESDFPRAQTVNSFDLMQYASKKGDRARRD
DDRYLFLEALLSAQQFFYISYIGQSNINNKQHLPSVMVSQLLDYFAEYLA
PQSLALVSPQGKFSEQHFFAEMVQQHPLTVFSLNNFSETNYAYDREWLTM
TQTEKMQEFCPGEFNSNAELPTEIQLEQLIKFVVNPVQYFFNQHLGIYFR
DNNKQIEESEKFVLNALDRYKLRDKLVCLDDDLIQQMFEQEKLKGNLPAA
NFAQLAQQKIVASVNIIKDELVGYLTESEILEVDQTFLINGIELRVVGNI
CHRFGDEIVFWKVSGLKDKDYIRYWLYYLFLRIQSQPLKLKIIYLDENKK
KVFQFNEISQDDAEKQLRIYLTDYLSSFSCLKWAMFEGLDDYFKNLNKAE
NIEHYCQENLEKLIGKEFFNSRYLKRILNQSVMLDYGSIHSTTLQWFELM
QTSKKSPHSKENE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTACGGTCTATTTTTCTCAGAAGCTATCATCACTCGCTAAATTATT
TATTCAATTACAGCAAAGCAATCCTAATCCTAATCCATTTGAAGCAGAAA
TTGTTTTAGTGCAAAGTGTAGGAATGGCACAATGGTTACAAATGCAAATT
GCCAATCAAATAGGGATCGCAGGTAACTATGAATTCCCTTTTCCTACGAG
TTTTTTATGGCAACAATATCGTGTCCTCTTTCCTGAACTTCCTACTGAAA
ATATTTTTGAACGTGAAACGGTTACTTGGCGTTTAATACGTTTAATTCCA
GATTATTTATCTTTACCTGAATTTCAATCTTTACAGCACTATTTAACTAA
AGATTCGCGTCAATACCAATTAAAGCTTTATCAATTAGCTAAAAAAGTAG
CGGATTTATTTGATCAGTATTTAGTTTATCGTCCACATTGGTTGGTTCAT
TGGGAAAATGATCGGCTTGAGATTGTTCGAGATGAAATTCTGAACCATGC
AAATTTAAAAGTGAAAAATAGCGAAGATATTTGGCAAAATTTAAGTTGGC
AGGCTATTTTATGGCGCGCATTAATTAATGATATTAAATTAGATTGTGAT
GAATCGGTGTTTGTGACTTCACATCGTGCTTATTTGCAAGAACAGTATTT
TAATAAATTAGATAATTTAACAGAAATAGAAAAATCAAAATTACCTAAGC
GGGTCTTTATTTTTGGTATTTCCTCTTTGCCCGCGACGCAATTAGCTGTT
TTAAAAAAGCTCAGTGAACATTGTCAAATTCATCTCTTCTTTTTGAATCC
AAGTGCAGAATATTGGGGAGATAATGTTGAAGATCGGGTATTAGAGAAAT
TAGCACTTAAGCAGAAAATGACCGCTAAAGAATTAGAAGCGTTATTTGTA
CAGAAAAATAATCAGTTATTATCAATGTGGGGTAAGCAAGGGCGTGATTT
TTTAGCACAAATTCTTGAGCAAGAACCCGACCAAATTCTTGATGTTTTTG
ATGCTTGTGAAGGCGATTCAAATCTGATTAAGTTAAAGAACGCCATTCTT
TCTTTTGATAATCCTCAACAATTATTGCTTGCTTCGCAAGATGATTCAGT
ACAGTTTCACTCTTGCCATAGCATTATGCGAGAAGTGGAAGTATTGCATA
ACCGTTTATTGCAAATGTTTGCTCAAGATCCAACATTGGCTGCAAAAGAT
ATTATTGTCATGTCAGCCGATATTAACCAATATGCGCCTTATATTGAAGC
GGTCTTTTCGCGTTATATGAAAGAAGATAAACGCTATATCCCATTCGCTT
TTGCTGATCAGAAGGCCATAACGGTTGATCCAATTCTGATGAGTTTTATG
AGTCTGCTTAACTTAAAGGAAAGCTTGTTTGATGCGGAATCATTGCTTGA
TTTATTAGATGTGAATGCAATTAGAGAACGTTTTCAGTTTCAGTTACAAG
ATATTCATATTGTACGGCATTGGGTTAATCAAGCAGGAATTCGTTTTGGT
TTAACGATCGATCAATCAGAATGGCAAAATTATAATGCGTGGCAAAATGG
TTTAACTCGTTTATTGATGGGCATTAGCCTAAGAGAAGAAAATGGCATTT
GGCAGGATAGTGTAGCTTTTAATGAAAGTTATGGTTTATCGGCAGAGCTT
GTTGGTTATTTAGCAAACTTTATTGAAAAATTGAGTGCTTGGCATCAAAT
TATTCAACAAAAACAGCCTATTGAAGTATGGCAAAAACAACTTTCATTAT
TGATTAATGATTTTTATCAAGAAAATGAAGAAAGCGTTCACGCAATTAAT
TTATTAAATATCGCCTTAGCAGAAATTATCCAAAAAATAACAGATGCGAA
ATTTGAACAGCAAATTGATATTGAAATTATTAGTTTATTGTTTAATGAAA
AATTGAATAGCCAACAAAATAACTTAAATTTCCTGGTCGGTAAGGTAAAT
TTTTGCACTTTATTACCTATGCGCGCCATTCCATTTAAAGTTGTTTGCTT
ATTAGGTATGAATGAAAGCGATTTTCCGCGTGCACAGACGGTGAATAGTT
TTGATTTAATGCAGTATGCCTCTAAAAAAGGCGATCGGGCTCGGCGTGAT
GATGATCGTTATTTATTTTTAGAAGCACTATTATCAGCACAACAATTTTT
CTATATTAGTTATATTGGACAATCTAATATTAATAATAAGCAACATTTAC
CATCGGTGATGGTTTCGCAGTTACTAGATTATTTCGCTGAATATCTTGCG
CCTCAATCTTTAGCATTAGTCAGCCCACAAGGTAAATTTTCTGAACAGCA
CTTTTTTGCAGAAATGGTGCAACAACATCCATTAACAGTATTTAGCTTAA
ACAACTTTAGCGAAACAAATTATGCCTATGATCGAGAATGGCTCACCATG
ACCCAAACGGAAAAAATGCAAGAGTTTTGCCCGGGTGAATTTAATTCAAA
CGCTGAATTGCCTACTGAAATTCAGCTCGAACAGTTAATTAAGTTTGTGG
TCAATCCGGTGCAGTATTTCTTTAATCAGCATTTAGGTATTTATTTTAGG
GATAATAATAAACAGATTGAAGAAAGTGAAAAATTTGTATTGAATGCATT
AGATCGTTATAAACTACGTGATAAATTGGTTTGCTTAGATGATGATTTAA
TTCAGCAAATGTTTGAACAGGAAAAGCTGAAAGGTAATTTACCCGCGGCG
AATTTTGCTCAACTAGCACAACAAAAAATTGTAGCATCGGTTAACATTAT
AAAAGACGAATTAGTGGGTTATTTAACCGAAAGTGAGATTTTAGAAGTTG
ATCAGACCTTTTTAATTAATGGAATCGAATTACGTGTTGTAGGTAATATT
TGCCATAGGTTTGGTGATGAAATTGTTTTTTGGAAAGTCAGTGGTTTAAA
AGATAAAGATTATATTCGTTATTGGCTTTATTATTTGTTTCTTCGAATAC
AATCACAACCGTTGAAATTAAAGATTATCTATTTAGATGAAAATAAAAAG
AAAGTATTCCAATTTAATGAAATTAGCCAAGATGATGCAGAAAAGCAATT
ACGCATTTATTTAACCGATTATTTATCCAGTTTTTCTTGTTTAAAATGGG
CTATGTTTGAAGGTTTAGATGATTATTTTAAAAATCTTAATAAGGCTGAA
AATATTGAGCACTACTGTCAGGAAAACTTAGAAAAGTTAATCGGAAAAGA
ATTTTTTAATAGTCGCTATTTAAAACGTATTTTAAATCAAAGCGTAATGT
TAGATTATGGTAGTATTCACAGTACTACATTACAATGGTTTGAGTTAATG
CAAACTAGTAAAAAAAGCCCTCATAGTAAGGAAAATGAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy