Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR121 IGR119 IGR122 IGR118 IGR120 IGR117 IGR116 HD0175 HD0178 HD0185 fabA, - HD0181 gph, - HD0176 HD0183 lgt,umpA, - HD0174 trpS, - HD0177 lonB, - HD0179 recC, - HD0186 HD0175 HD0178 HD0185 fabA, - HD0181 gph, - HD0176 HD0183 lgt,umpA, - HD0174 trpS, - HD0177 lonB, - HD0179 recC, - HD0186 HD0175 HD0178 fabA, - HD0181 gph, - HD0176 lgt,umpA, - HD0174 trpS, - HD0177 lonB, - HD0179 recC, - HD0186 HD0180 HD0182 HD0184 HD0185 HD0183 HD0180 HD0182 HD0184
* Calculated from Protein Sequence

Gene ID: HD0181

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
fabA  

Definition:
D-3-hydroxydecanoyl-(acyl-carrier protein) dehydratase

Gene Start:
121661

Gene Stop:
122191

Gene Length:
531

Molecular Weight*:
19265

pI*:
6.30

Net Charge*:
-1.43

EC:
4.2.1.60  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid biosynthesis (path 1)

Secondary Evidence:
Marrakchi H, Choi KH, Rock CO.
A new mechanism for anaerobic unsaturated fatty acid formation in streptococcus pneumoniae.
J Biol Chem. 2002 Sep 16 [epub ahead of print]
PMID: 12237320

Zhang YM, Marrakchi H, Rock CO.
The FabR (YijC) transcription factor regulates unsaturated fatty acid biosynthesis in Escherichia coli.
J Biol Chem. 2002 May 3;277(18):15558-65.
PMID: 11859088

Comment:
0

Blast Summary:  PSI-Blast Search
Residues 2 to 176 are 78% ( EScore : 7e-74 ) identical to sp|P45159|FABA_HAEIN 3-HYDROXYDECANOYL-[ACYL-CARRIER-PROTEIN] DEHYDRATASE between residues 3 and 177 in [Haemophilus influenzae Rd]
Residues 9 to 176 are 73% ( EScore : 1e-67 ) identical to gb|AAC44399.1| (U56977) 3-hydroxydecanoyl-[acyl carrier protein] dehydrase between residues 5 and 172 in [Escherichia coli]
Residues 9 to 176 are 73% ( EScore : 1e-67 ) identical to sp|P18391|FABA_ECOLI 3-HYDROXYDECANOYL-[ACYL-CARRIER-PROTEIN] DEHYDRATASE between residues 5 and 172 in [Escherichia coli]
Residues 9 to 176 are 73% ( EScore : 1e-67 ) identical to pdb|1MKA|A between residues 4 and 171
Residues 9 to 176 are 73% ( EScore : 2e-66 ) identical to gb|AAC44389.1| (U37057) beta-hydroxydecanoyl-ACP dehydrase between residues 5 and 172 in [Escherichia coli]
Residues 15 to 176 are 59% ( EScore : 1e-48 ) identical to gb|AAC45619.1| (U70470) beta-hydroxydecanoyl-ACP dehydrase between residues 10 and 171 in [Pseudomonas aeruginosa]
Residues 11 to 176 are 52% ( EScore : 1e-42 ) identical to gb|AAF83382.1|AE003904_3 beta-hydroxydecanoyl-ACP dehydratase between residues 7 and 173 in [Xylella fastidiosa]
Residues 31 to 94 are 48% ( EScore : 3e-10 ) identical to pir||T37057 probable multi-domain beta keto-acyl synthase - Streptomyces coelicolor >5708241|emb|CAB52354.1| between residues 2085 and 2148 in [Streptomyces coelicolor A3(2)]
Residues 9 to 167 are 23% ( EScore : 5e-08 ) identical to dbj|BAA89384.1| (AB025342) ORF10 between residues 1364 and 1540 in [Moritella marina]
Residues 47 to 169 are 26% ( EScore : 9e-06 ) identical to pir||T30185 hypothetical protein 7 - Shewanella sp >2529420|gb|AAB81125.1| between residues 1871 and 2000 in [Shewanella sp. SCRC-2738]

COGS Summary:  COGS Search
BeTs to 4 clades of COG0764
COG name: 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases
Functional Class:  I
The phylogenetic pattern of COG0764 is -----qvcEB-Huj----inx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 7-176 are 78% similar to a (PROTEOME DEHYDRATASE COMPLETE) protein domain (PD013327) which is seen in Q9CNE8_PASMU.



Paralogs:  Local Blast Search

HD0181 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1MKA|A Chain A, E. Coli Beta-Hydroxydecanoyl Thiol Ester De... 256 2e-069
pdb|1MKA|A Chain A, E. Coli Beta-Hydroxydecanoyl Thiol Ester De... 297 7e-082

Gene Protein Sequence:
MNNCTPNIKSSYGYEDLLASGRGELFGKEGPQLPAPTMLMMDRVNLMTEN
GGLFDKGYIEAELDIHPDLPFFGCHFIGDPVMPGCLGLDAMWQLVGFFLG
WIGGKGKGRALGVGEVKFTGQILPTAKKVTYRIHMKRVINRKLVMGLADG
EVEVDGRVIYTATDLKVGLFQDTSSF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACAATTGTACACCTAATATCAAGTCAAGTTATGGTTATGAAGATTT
ATTAGCTTCAGGACGGGGTGAATTATTTGGCAAAGAAGGACCACAATTAC
CTGCGCCAACAATGTTAATGATGGATAGAGTTAACTTAATGACTGAAAAT
GGTGGCTTATTTGATAAAGGTTATATTGAGGCAGAACTTGATATTCACCC
AGATTTACCTTTCTTTGGTTGTCATTTTATTGGCGACCCGGTTATGCCTG
GCTGTTTAGGTCTAGATGCTATGTGGCAATTGGTTGGTTTTTTCCTTGGC
TGGATTGGGGGTAAAGGTAAAGGCCGTGCATTGGGCGTTGGCGAAGTAAA
ATTCACCGGTCAAATTTTACCAACAGCGAAAAAAGTCACTTATAGAATTC
ATATGAAACGCGTAATTAACCGTAAGTTAGTAATGGGATTAGCCGATGGT
GAAGTAGAAGTAGATGGCCGTGTGATTTATACCGCTACAGATTTGAAAGT
GGGGTTATTCCAAGACACATCATCATTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy