Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR121 IGR119 IGR115 IGR122 IGR118 IGR120 IGR117 IGR116 HD0175 HD0178 HD0185 fabA, - HD0181 gph, - HD0176 HD0183 HD0173 lgt,umpA, - HD0174 trpS, - HD0177 lonB, - HD0179 recC, - HD0186 HD0175 HD0178 HD0185 fabA, - HD0181 gph, - HD0176 HD0183 HD0173 lgt,umpA, - HD0174 trpS, - HD0177 lonB, - HD0179 recC, - HD0186 HD0175 HD0178 fabA, - HD0181 gph, - HD0176 HD0173 lgt,umpA, - HD0174 trpS, - HD0177 lonB, - HD0179 recC, - HD0186 HD0180 HD0182 HD0184 HD0185 HD0183 HD0180 HD0182 HD0184
* Calculated from Protein Sequence

Gene ID: HD0179

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lonB  

Definition:
lon protease

Gene Start:
119913

Gene Stop:
121550

Gene Length:
1638

Molecular Weight*:
61360

pI*:
5.10

Net Charge*:
-15.92

EC:
3.4.21.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to lon proteases.Residues 24-523 are 42% similar to this protein from Haemophilus influenzae (1170810|) and residues 104-525 are 41% similar to this protein from Salmonella typhimurium (16764427|).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1068
COG name: ATP-dependent unnamed protease
Functional Class: O
The phylogenetic pattern of COG1068 is ------v-e--h-----l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 376-425 are 84% similar to a (PROTEASE COMPLETE PROTEOME ATP-DEPENDENT) protein domain (PD216577) which is seen in LONH_HAEIN.

Residues 90-249 are 36% similar to a (PROTEASE PROTEOME COMPLETE LA-RELATED) protein domain (PD303365) which is seen in Q9CNE9_PASMU.

Residues 430-496 are 52% similar to a (PROTEASE ATP-DEPENDENT LA ATP-BINDING HYDROLASE SERINE) protein domain (PD231765) which is seen in LONH_ECOLI.

Residues 104-364 are 34% similar to a (PROTEASE COMPLETE PROTEOME ATP-DEPENDENT) protein domain (PD043584) which is seen in LONH_ECOLI.

Residues 427-523 are 45% similar to a (PROTEASE PROTEOME COMPLETE PM0483) protein domain (PD414945) which is seen in LONH_HAEIN.

Residues 271-375 are 58% similar to a (PROTEASE PROTEOME COMPLETE PM0483) protein domain (PD414972) which is seen in Q9CNE9_PASMU.



Paralogs:  Local Blast Search
HD0179 is paralogously related to HD1149 (3e-05).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VILTPIAHQLLTLQHTFKPTNAKVDFFDFQTNAKQAIDLFKQAQFGSLLV
IKTETFPEFIESITGYVAKDLTSPLIVRTEFNRNHLFGYSLYLDKQQRLE
NVEGAIQQAEQGILVLNVKALLLDITQWDKLKQALLFGCYEPHAMNHIPS
LLANIEAHFKLILVGNREDIALLAEYDESLYQFAHYTEIESYFSFNAENR
QMWGDYVQTMAEKWCQRSFLMQALTQFLQAYIRESEDQSRISISPTLLKK
HLLGLTNFYANQTAFAQVASYFSYLEQQSAVLNKYTLQDMLTNQLYIDTA
GELIGQINALSVIEFDGIPYAFGEPLRISCNVQYGDGEITDIERKVELGG
NIHSKGIIIAQSCLANLLAFPTQLPFSASLAFEQSYGEVDGDSSSLAILC
VLISALAKLPLPQSIAVTGSIDQFGNVLSVGGVNQKIEGFFNLCKARQLT
GKQGVIIPATCLSHLSLTSDVINAIKAKQFHIWSVKNIFEAVWILLEHHF
YDEDQTTANDKPTIFNLIHQQLEQEQENSASGSFFAKIYQLFTKN$

Gene Nucleotide Sequence:  Sequence Viewer
GTGATTCTAACTCCCATTGCACATCAATTGCTAACTTTACAGCATACTTT
TAAACCCACTAATGCTAAGGTCGATTTTTTTGATTTTCAAACTAATGCCA
AGCAAGCGATTGATTTGTTTAAACAGGCGCAATTTGGTTCATTGTTAGTT
ATCAAAACCGAGACTTTTCCTGAATTTATCGAAAGTATAACCGGTTATGT
TGCGAAAGATTTAACTTCGCCGTTAATTGTGAGAACGGAATTTAATCGAA
ATCATTTGTTTGGCTATAGTCTTTATTTAGATAAACAACAACGACTAGAA
AATGTTGAGGGCGCTATTCAACAAGCCGAGCAAGGCATTTTAGTGTTAAA
TGTGAAAGCATTATTATTAGATATTACGCAATGGGATAAGTTAAAACAGG
CATTGTTATTTGGTTGCTATGAACCGCACGCGATGAATCATATTCCTTCG
TTATTAGCTAACATTGAAGCACATTTTAAATTGATCTTAGTTGGTAACCG
TGAGGATATTGCATTATTAGCAGAATATGATGAAAGCTTATATCAATTTG
CCCACTATACAGAAATCGAATCTTATTTTTCATTCAATGCAGAGAATCGA
CAAATGTGGGGTGACTATGTGCAAACGATGGCAGAAAAATGGTGCCAAAG
AAGTTTTTTAATGCAGGCATTAACTCAGTTTTTACAAGCCTATATCCGCG
AAAGTGAAGATCAAAGCCGTATTTCAATTTCACCAACCTTATTAAAAAAA
CATTTGTTAGGATTAACCAATTTTTATGCAAATCAGACCGCTTTTGCTCA
AGTGGCAAGTTATTTCAGTTATTTAGAACAGCAATCTGCGGTGTTAAATA
AATATACGTTGCAAGATATGCTCACTAATCAGCTGTATATTGATACTGCA
GGCGAATTGATCGGGCAGATTAATGCGTTATCAGTAATTGAGTTTGACGG
TATCCCATACGCTTTTGGTGAGCCGTTACGAATTAGTTGTAATGTGCAAT
ATGGCGATGGTGAAATTACGGATATTGAAAGAAAAGTAGAGTTAGGCGGG
AATATTCACTCAAAAGGCATTATTATTGCGCAATCTTGTTTAGCTAATTT
ACTTGCTTTTCCCACACAACTACCTTTCTCGGCTTCGTTAGCATTTGAGC
AATCTTATGGTGAAGTTGATGGCGATAGTTCCTCTTTAGCGATTTTATGT
GTATTGATCAGCGCATTGGCTAAGTTACCATTGCCACAATCAATTGCAGT
AACGGGCTCGATCGACCAATTTGGTAATGTATTAAGTGTTGGTGGAGTTA
ATCAAAAAATTGAGGGCTTTTTTAATCTTTGTAAAGCGCGTCAGTTAACA
GGTAAACAAGGCGTTATTATTCCTGCCACTTGCCTTTCTCATTTAAGTTT
AACCTCAGACGTGATCAATGCAATTAAAGCAAAACAATTCCATATTTGGA
GCGTCAAAAATATCTTTGAGGCCGTATGGATTTTATTAGAACATCATTTT
TATGATGAAGACCAAACAACAGCAAACGATAAACCAACTATTTTCAATTT
GATTCATCAACAACTTGAACAAGAACAAGAAAATTCTGCTAGCGGGTCAT
TTTTTGCAAAAATTTACCAATTATTTACCAAAAACTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy