Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR114 IGR119 IGR113 IGR115 IGR112 IGR110 IGR118 IGR120 IGR117 IGR116 IGR111 HD0175 HD0170 HD0168 HD0178 HD0171 ppa,ipyR, - HD0169 fabA, - HD0181 invA,ygdP,nudH, - HD0172 gph, - HD0176 HD0183 HD0173 lgt,umpA, - HD0174 trpS, - HD0177 lonB, - HD0179 HD0175 HD0170 HD0168 HD0178 HD0171 ppa,ipyR, - HD0169 fabA, - HD0181 invA,ygdP,nudH, - HD0172 gph, - HD0176 HD0183 HD0173 lgt,umpA, - HD0174 trpS, - HD0177 lonB, - HD0179 HD0175 HD0170 HD0168 HD0178 ppa,ipyR, - HD0169 fabA, - HD0181 invA,ygdP,nudH, - HD0172 gph, - HD0176 HD0173 lgt,umpA, - HD0174 trpS, - HD0177 lonB, - HD0179 HD0180 HD0182 HD0184 HD0183 HD0180 HD0171 HD0182 HD0184
* Calculated from Protein Sequence

Gene ID: HD0177

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
trpS  

Definition:
tryptophanyl-tRNA synthetase (TrpS)

Gene Start:
118265

Gene Stop:
119293

Gene Length:
1029

Molecular Weight*:
38536

pI*:
6.50

Net Charge*:
-1.30

EC:
6.1.1.2  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Tryptophan metabolism

Secondary Evidence:
Barstow,D.A., Sharman,A.F., Atkinson,T. and Minton,N.P.
Cloning and complete nucleotide sequence of the Bacillus
stearothermophilus tryptophanyl tRNA synthetase gene
Gene 46 (1), 37-45 (1986)
Medline: 87106841

Winter,G.P. and Hartley,B.S.
The amino acid sequence of tryptophanyl tRNA synthetase from
Bacillus stearothermophilus
FEBS Lett. 80 (2), 340-342 (1977)
Medline: 77246821


Doublie,S., Bricogne,G., Gilmore,C. and Carter,C.W. Jr.
Tryptophanyl-tRNA synthetase crystal structure reveals an
unexpected homology to tyrosyl-tRNA synthetase
Structure 3 (1), 17-31 (1995)
Medline: 95261702

Ilyin,V.A., Temple,B., Hu,M., Li,G., Yin,Y., Vachette,P. and
Carter,C.W. Jr.
2.9 A crystal structure of ligand-free tryptophanyl-tRNA
synthetase: domain movements fragment the adenine nucleotide
binding site
Protein Sci. 9 (2), 218-231 (2000)
Medline: 20178918


Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to tryptophanyl-tRNA synthetases. Residues 1-341 are 79% similar to this enzyme from Pasteurella multocida (15603486|) and are 75% similar to this enzyme from Haemophilus influenzae (1174552|).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0180
COG name: Tryptophanyl-tRNA synthetase
Functional Class: J
The phylogenetic pattern of COG0180 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 93-126 are 91% similar to a (SYNTHETASE LIGASE TRYPTOPHANYL-TRNA) protein domain (PD393365) which is seen in SYW_PASMU.

Residues 128-236 are 80% similar to a (SYNTHETASE LIGASE TRYPTOPHANYL-TRNA) protein domain (PD247980) which is seen in SYW_PASMU.

Residues 268-340 are 67% similar to a (SYNTHETASE LIGASE TRYPTOPHANYL-TRNA) protein domain (PD333617) which is seen in SYW_PASMU.

Residues 210-280 are 52% similar to a (LIGASE SYNTHETASE TRPRS ATP-BINDING) protein domain (PD263345) which is seen in SYW_BUCAI.

Residues 1-124 are 72% similar to a (SYNTHETASE LIGASE TRYPTOPHANYL-TRNA) protein domain (PD129039) which is seen in Q9KNV7_VIBCH.

Residues 128-236 are 37% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD001451) which is seen in SYW_AQUAE.



Paralogs:  Local Blast Search
HD0177 is paralogously related to HD0693 (5e-04).


Pfam Summary:  Pfam Search
Residues 3 to 296 (E-value = 8e-117) place HD0177 in the tRNA-synt_1b family which is described as tRNA synthetases class I (W and Y) (PF00579)

PDB Hit:
pdb|1D2R|A Chain A, 2.9 A Crystal Structure Of Ligand-Free Tryp... 336 3e-093
pdb|1D2R|A Chain A, 2.9 A Crystal Structure Of Ligand-Free Tryp... 554 7e-159

Gene Protein Sequence:
MTKSIVFSGVQPSGELTIGNYLGALRNWVTLQDDYDCLFCIVDLHAITVR
QDPIALRKSTLDVLALYLACGIDPNKSTIFIQSQVPEHSQLAWVLNCYTY
FGEMGRMTQFKDKSARYEENVNVGLFTYPVLMAADILLYQANQVPVGDDQ
KQHLEITRDIANRFNTLYGKKDAEGKLIESVFTVPECFIAKACARVMSLL
EPTKKMSKSDDNRNNVIGLLEDPKAVAKKIKRAMTDSDEPPVIKYDQKNK
AGVSNLLDILAAITGKSMVELEAEFEGKMYGHLKTEVADQVMAMLTGLQE
RYQRFRQDEALLEKIYRDGAEKARMRAKKTLDEVYKLIGFVG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCAAATCTATTGTATTTAGTGGTGTTCAGCCATCTGGTGAGCTAAC
AATTGGCAATTATTTAGGCGCATTACGTAATTGGGTCACACTGCAAGATG
ACTATGATTGCCTTTTTTGTATTGTTGATTTACACGCCATTACCGTCCGC
CAAGATCCTATCGCATTACGTAAATCGACCTTAGATGTTTTAGCGCTTTA
TTTGGCCTGTGGTATTGATCCTAATAAAAGCACTATTTTCATTCAATCGC
AGGTGCCAGAACATTCACAATTAGCTTGGGTTTTAAATTGTTACACTTAT
TTTGGTGAAATGGGGCGGATGACGCAATTTAAAGATAAATCTGCTCGTTA
TGAGGAAAATGTCAATGTAGGATTATTTACTTATCCGGTATTAATGGCGG
CAGATATTTTGCTCTATCAAGCTAATCAAGTGCCGGTCGGTGACGATCAA
AAACAGCATTTGGAAATTACGCGTGATATCGCTAATCGTTTTAATACGTT
ATACGGCAAAAAGGATGCGGAAGGAAAGCTGATTGAATCGGTTTTTACTG
TGCCAGAATGTTTTATTGCCAAAGCGTGTGCAAGGGTGATGTCTTTGCTT
GAACCGACTAAAAAAATGTCTAAGTCAGATGATAACCGTAATAATGTGAT
CGGTTTATTAGAAGATCCTAAAGCGGTCGCTAAGAAAATTAAACGGGCTA
TGACAGATAGCGATGAGCCACCGGTGATAAAATATGATCAAAAAAATAAA
GCGGGAGTATCTAATTTATTAGATATTTTAGCTGCGATAACCGGTAAAAG
TATGGTTGAATTGGAAGCAGAATTTGAAGGTAAAATGTATGGCCATTTAA
AAACAGAAGTCGCCGATCAAGTTATGGCAATGTTAACAGGGTTACAAGAA
CGCTATCAAAGATTCCGTCAAGATGAAGCATTATTAGAAAAAATTTACCG
TGATGGTGCTGAAAAAGCACGTATGCGTGCGAAGAAAACTTTAGATGAAG
TATATAAGTTGATTGGTTTTGTCGGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy