Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR114 IGR119 IGR113 IGR108 IGR115 IGR112 IGR110 IGR118 IGR120 IGR117 IGR116 IGR111 IGR109 HD0167 HD0175 HD0170 HD0168 HD0178 HD0171 menG, - HD0166 ppa,ipyR, - HD0169 fabA, - HD0181 HD0182 invA,ygdP,nudH, - HD0172 gph, - HD0176 HD0173 lgt,umpA, - HD0174 trpS, - HD0177 lonB, - HD0179 HD0167 HD0175 HD0170 HD0168 HD0178 HD0171 menG, - HD0166 ppa,ipyR, - HD0169 fabA, - HD0181 HD0182 invA,ygdP,nudH, - HD0172 gph, - HD0176 HD0173 lgt,umpA, - HD0174 trpS, - HD0177 lonB, - HD0179 HD0175 HD0170 HD0168 HD0178 HD0167 menG, - HD0166 ppa,ipyR, - HD0169 fabA, - HD0181 HD0182 invA,ygdP,nudH, - HD0172 gph, - HD0176 HD0173 lgt,umpA, - HD0174 trpS, - HD0177 lonB, - HD0179 HD0180 HD0180 HD0171
* Calculated from Protein Sequence

Gene ID: HD0176

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
gph  

Definition:
phosphoglycolate phosphatase

Gene Start:
117435

Gene Stop:
118097

Gene Length:
663

Molecular Weight*:
24347

pI*:
5.10

Net Charge*:
-5.18

EC:
3.1.3.18  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table
Glyoxylate and dicarboxylate metabolism

Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to phosphoglycolate phosphatase (gph). Residues 1-218 are 55% similar to this enzyme from Pasteurella multocida (17432942|) and residues 2-218 are 52% similar to this enzyme from Haemophilus influenzae (1176246|).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0546
COG name: Predicted phosphatases
Functional Class: R
The phylogenetic pattern of COG0546 is a-TkyQ-CEBRhuj--oL---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR00413 (Haloacid dehalogenase/epoxide hydrolase family signature) with a combined E-value of 1.2e-08.
    PR00413A    4-15
    PR00413D    103-116
    PR00413E    134-150
    PR00413F    152-172
***** IPB000150 (Cof protein) with a combined E-value of 1.7e-06.
    IPB000150A    3-17
    IPB000150C    168-200


ProDom Summary:  Protein Domain Search
Residues 96-215 are 61% similar to a (PROTEOME COMPLETE HYDROLASE PHOSPHATASE) protein domain (PD000816) which is seen in GPH_HAEIN.

Residues 9-60 are 59% similar to a (PHOSPHATASE PHOSPHOGLYCOLATE PROTEOME) protein domain (PD003468) which is seen in Q9CKJ5_PASMU.



Paralogs:  Local Blast Search
HD0176 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 193 (E-value = 1.8e-38) place HD0176 in the Hydrolase family which is described as haloacid dehalogenase-like hydrolase (PF00702)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSKYKVIGFDLDGTLVNTLPDLTLVVNAMFTEHHLPVTTADKVLSWIDKG
ADIFFQNAIAETAKDFDAKQLAEMRASFDKYYATYICEKSQLYPNVKQTL
EMLKARGFILVVITNKPTKLVEPVLTTFGIFELFSAYLGGQSLAKIKPHP
DPMLHICQKFAIKPWEMLFVGDSENDVIAAKAAGCDVVGLTYGYNYNVPI
ADSTPTFVTSDFADVLQIAG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCAAATATAAAGTGATTGGTTTTGATCTTGATGGCACGCTAGTCAA
TACTTTGCCAGATTTAACGTTAGTGGTAAATGCTATGTTTACTGAACATC
ATTTACCCGTGACCACAGCAGATAAAGTGCTGAGTTGGATTGACAAAGGC
GCAGATATTTTCTTTCAGAATGCAATAGCAGAGACTGCAAAAGATTTTGA
TGCGAAGCAACTTGCCGAAATGCGTGCTAGTTTTGATAAATATTATGCCA
CTTATATTTGTGAAAAGAGTCAGCTTTATCCAAATGTGAAGCAGACATTG
GAAATGTTAAAAGCACGGGGCTTTATTTTAGTGGTGATTACCAATAAGCC
AACGAAATTAGTTGAACCTGTGTTAACTACTTTTGGTATTTTTGAATTAT
TTAGTGCTTATTTAGGTGGGCAATCACTCGCGAAAATTAAGCCACACCCT
GATCCGATGTTACATATCTGCCAAAAATTTGCGATTAAACCTTGGGAAAT
GTTATTTGTCGGTGATTCTGAAAATGATGTGATTGCCGCTAAAGCAGCCG
GCTGTGATGTAGTGGGCTTGACTTATGGTTATAATTATAACGTGCCGATA
GCTGATTCAACCCCGACTTTTGTGACAAGTGATTTTGCTGATGTGTTACA
GATTGCAGGCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy