Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR114 IGR119 IGR113 IGR108 IGR112 IGR115 IGR110 IGR118 IGR117 IGR107 IGR116 IGR111 IGR109 HD0167 HD0175 HD0170 HD0168 HD0178 HD0171 menG, - HD0166 ppa,ipyR, - HD0169 fabA, - HD0181 invA,ygdP,nudH, - HD0172 gph, - HD0176 HD0173 lgt,umpA, - HD0174 trpS, - HD0177 mqo, - HD0165 lonB, - HD0179 HD0167 HD0175 HD0170 HD0168 HD0178 HD0171 menG, - HD0166 ppa,ipyR, - HD0169 fabA, - HD0181 invA,ygdP,nudH, - HD0172 gph, - HD0176 HD0173 lgt,umpA, - HD0174 trpS, - HD0177 mqo, - HD0165 lonB, - HD0179 HD0175 HD0170 HD0168 HD0178 HD0167 menG, - HD0166 ppa,ipyR, - HD0169 invA,ygdP,nudH, - HD0172 gph, - HD0176 HD0173 lgt,umpA, - HD0174 trpS, - HD0177 mqo, - HD0165 lonB, - HD0179 HD0180 fabA, - HD0181 HD0171 HD0180
* Calculated from Protein Sequence

Gene ID: HD0174

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lgt  umpA  

Definition:
prolipoprotein diacylglyceryl transferase

Gene Start:
116564

Gene Stop:
117361

Gene Length:
798

Molecular Weight*:
29848

pI*:
9.10

Net Charge*:
1.48

EC:
2.4.99.-  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Lipopolysaccharide biosynthesis
Sphingoglycolipid metabolism

Secondary Evidence:
Zhu P, Klutch MJ, Bash MC, Tsang RS, Ng LK, Tsai CM.
Genetic diversity of three lgt loci for biosynthesis of lipooligosaccharide (LOS) in Neisseria species.
Microbiology. 2002 Jun;148(Pt 6):1833-44.
PMID: 12055303

Leskela S, Wahlstrom E, Kontinen VP, Sarvas M.
Lipid modification of prelipoproteins is dispensable for growth but essential for efficient protein secretion in Bacillus subtilis: characterization of the Lgt gene.
Mol Microbiol. 1999 Feb;31(4):1075-85.
PMID: 10096076

Comment:
0

Blast Summary:  PSI-Blast Search
Residues 21 to 264 are 66% ( EScore : 4e-93 ) identical to sp|P44930|LGT_HAEIN PROLIPOPROTEIN DIACYLGLYCERYL TRANSFERASE >1075177|pir||F64101 prolipoprotein diacylglyceryl transferase between residues 23 and 265 in [Haemophilus influenzae Rd]
Residues 17 to 260 are 61% ( EScore : 3e-91 ) identical to emb|CAA07072.1| (AJ006514) prolipoprotein diacylglyceryl transferase between residues 17 and 260 in [Vibrio cholerae]
Residues 17 to 260 are 55% ( EScore : 9e-81 ) identical to sp|P37149|LGT_ECOLI PROLIPOPROTEIN DIACYLGLYCERYL TRANSFERASE >1361241|pir||A56149 prolipoprotein diacylglyceryl transferase between residues 17 and 283 in [Escherichia coli]
Residues 17 to 260 are 55% ( EScore : 3e-80 ) identical to gb|AAB40475.1| (U29581) prolipoprotein diacylglyceryl transferase between residues 17 and 283 in [Escherichia coli]
Residues 17 to 260 are 54% ( EScore : 6e-79 ) identical to sp|Q07293|LGT_SALTY PROLIPOPROTEIN DIACYLGLYCERYL TRANSFERASE >1073688|pir||A47354 probable prolipoprotein glyceryl transferase - Salmonella typhimurium >295202|gb|AAA20896.1| between residues 17 and 283 in [Salmonella typhimurium]
Residues 17 to 261 are 45% ( EScore : 1e-58 ) identical to gb|AAF85132.1|AE004044_3 prolipoprotein diacylglyceryl transferase between residues 13 and 288 in [Xylella fastidiosa]
Residues 17 to 252 are 43% ( EScore : 2e-55 ) identical to emb|CAB84526.1| (AL162755) putative prolipoprotein diacylglyceryl transferase between residues 13 and 271 in [Neisseria meningitidis]
Residues 17 to 252 are 42% ( EScore : 3e-54 ) identical to gb|AAF41467.1| (AE002458) prolipoprotein diacylglyceryl transferase between residues 13 and 271 in [Neisseria meningitidis MC58]
Residues 17 to 251 are 32% ( EScore : 8e-37 ) identical to sp|Q9ZE99|LGT_RICPR PROLIPOPROTEIN DIACYLGLYCERYL TRANSFERASE >7433977|pir||F71712 prolipoprotein diacylglyceryl transferase between residues 21 and 258 in [Rickettsia prowazekii]
Residues 22 to 186 are 37% ( EScore : 2e-27 ) identical to sp|O33551|LGT_RHOSH PROLIPOPROTEIN DIACYLGLYCERYL TRANSFERASE >2292997|emb|CAA04426.1| between residues 24 and 202 in [Rhodobacter sphaeroides]

COGS Summary:  COGS Search
BeTs to 12 clades of COG0682
COG name: Prolipoprotein diacylglyceryltransferase
Functional Class:  M
The phylogenetic pattern of COG0682 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001640 (Prolipoprotein diacylglyceryl transferase) with a combined E-value of 2.4e-46.
    IPB001640A    19-33
    IPB001640B    98-108
    IPB001640C    129-154
    IPB001640D    173-191


ProDom Summary:  Protein Domain Search
Residues 18-256 are 66% similar to a (TRANSFERASE PROLIPOPROTEIN DIACYLGLYCERYL) protein domain (PD005412) which is seen in Q9CPG2_PASMU.

Residues 24-230 are 32% similar to a (TRANSFERASE PROLIPOPROTEIN DIACYLGLYCERYL) protein domain (PD360451) which is seen in LGT_TREPA.



Paralogs:  Local Blast Search

HD0174 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 11 to 261 (E-value = 5.3e-125) place HD0174 in the LGT family which is described as Prolipoprotein diacylglyceryl transferase (PF01790)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSEQFIQFPQIDPIIFSLGPISLRWYGLMYLIGFAFAYWLGMKRAKASGG
VWNGEQVDQLLYTGFWGVVLGGRVGDVLFYSFDRFLQDPLFLFRIWEGGM
SFHGGLIGVIVAMIWVSYRQQRSFWQTADFIAPLIPFGLGMGRIGNFIND
ELWGRVTDVPWAVLFPSGGYLPRHPSQLYEFLLEGVVLFGILNAFIKKPR
PMGSVAGLFLVGYGVFRFVVEYVRDIDPNVNTAADLITRGQLLSLPMIVG
GVGVMLWAYRSNKAE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCGAACAATTTATTCAATTTCCGCAAATTGATCCGATTATTTTCAG
TCTTGGGCCGATTTCACTACGTTGGTATGGCTTAATGTATTTAATTGGCT
TTGCTTTTGCTTATTGGTTAGGAATGAAAAGAGCAAAAGCATCTGGTGGT
GTCTGGAATGGTGAACAAGTGGATCAACTATTGTACACGGGATTTTGGGG
TGTAGTATTGGGTGGCCGTGTCGGTGATGTGTTGTTTTATAGTTTCGACC
GCTTCTTACAGGATCCGCTTTTTCTGTTTCGTATTTGGGAAGGCGGAATG
TCATTTCACGGTGGTTTAATCGGTGTGATTGTTGCAATGATTTGGGTTTC
TTACCGCCAACAACGTTCTTTTTGGCAGACGGCAGATTTTATTGCGCCGT
TAATTCCCTTTGGTTTAGGTATGGGACGCATTGGTAATTTTATTAATGAT
GAACTTTGGGGCAGAGTAACAGATGTGCCGTGGGCGGTGTTATTTCCGAG
TGGTGGCTATTTACCGCGTCATCCATCACAGTTGTATGAGTTTTTACTTG
AAGGGGTTGTGCTATTTGGTATTTTGAATGCCTTTATTAAAAAGCCACGT
CCAATGGGATCGGTAGCGGGCTTGTTTTTAGTTGGTTATGGCGTGTTTCG
TTTCGTAGTGGAATACGTTCGTGATATTGATCCAAATGTGAATACGGCAG
CGGATTTAATAACCCGTGGCCAGTTATTATCATTGCCGATGATTGTTGGC
GGTGTTGGCGTAATGTTATGGGCATATAGATCAAACAAAGCCGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy