Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR114 IGR113 IGR108 IGR112 IGR115 IGR110 IGR118 IGR117 IGR107 IGR106 IGR116 IGR111 IGR109 HD0167 HD0175 HD0170 HD0168 HD0178 HD0171 menG, - HD0166 ppa,ipyR, - HD0169 tfpB, - HD0163 invA,ygdP,nudH, - HD0172 gph, - HD0176 HD0173 lgt,umpA, - HD0174 trpS, - HD0177 mqo, - HD0165 lonB, - HD0179 HD0167 HD0175 HD0170 HD0168 HD0178 HD0171 menG, - HD0166 ppa,ipyR, - HD0169 tfpB, - HD0163 invA,ygdP,nudH, - HD0172 gph, - HD0176 HD0173 lgt,umpA, - HD0174 trpS, - HD0177 mqo, - HD0165 lonB, - HD0179 Type: tandem, Name:  - 2 HD0175 HD0170 HD0168 HD0178 HD0167 menG, - HD0166 ppa,ipyR, - HD0169 invA,ygdP,nudH, - HD0172 gph, - HD0176 HD0173 lgt,umpA, - HD0174 trpS, - HD0177 mqo, - HD0165 lonB, - HD0179 HD0164 tfpB, - HD0163 HD0171 HD0164
* Calculated from Protein Sequence

Gene ID: HD0172

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
invA  ygdP  nudH  

Definition:
(di)nucleoside polyphosphate hydrolase; possible invasion protein

Gene Start:
115107

Gene Stop:
115700

Gene Length:
594

Molecular Weight*:
23413

pI*:
10.70

Net Charge*:
14.15

EC:
3.6.1.-  

Functional Class:
Other categories; Adaptations and atypical conditions  

Pathway: pathway table
Folate biosynthesis
Starch and sucrose metabolism

Comment:
From Genbank:[gi:2497999]
This enzyme preferentially hydrolyzes diadenosine penta-phosphate
with ATP as one of the reaction products.It hydrolyzes diadenosine hexa- and tetra-phosphate.It has no activity on diadenosine
tri-phosphate, ADP-ribose, NADH and UDP-glucose. In the
meningitis causing strain E.coli K1, has been shown to play a role
in HBMEC (human brain microvascular endothelial cells) invasion in
vitro.

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to (di)nucleoside polyphosphate hydrolases. Residues 1-159 are 79% similar to (di)nucleoside polyphosphate hydrolase from Haemophilus influenzae (2498000|).Residues 1-158 are 72% similar to this enzyme from E.coli (15803349|).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0494
COG name: NTP pyrophosphohydrolases (MutT family) including oxidative damage repair enzymes
Functional Class: L,R
The phylogenetic pattern of COG0494 is a-T-YqvCEBRHuj---linx
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
***** IPB000086 (NUDIX hydrolase) with a combined E-value of 4.5e-10.
    IPB000086    33-59


ProDom Summary:  Protein Domain Search
Residues 95-156 are 88% similar to a (HYDROLASE 3.6.1.- PYROPHOSPHATASE) protein domain (PD012460) which is seen in NUDH_HAEIN.

Residues 1-74 are 75% similar to a (HYDROLASE 3.6.1.- POLYPHOSPHATE MANGANESE) protein domain (PD277202) which is seen in NUDH_PASMU.



Paralogs:  Local Blast Search
HD0172 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 151 (E-value = 6.1e-24) place HD0172 in the NUDIX family which is described as NUDIX domain (PF00293)

PDB Hit:
pdb|1TUM| Mutt Pyrophosphohydrolase-Metal-Nucleotide-Metal Co... 106 2e-024

Gene Protein Sequence:
VIDFDGYRPNVGIVICNKVGQVLWARRFGQNSWQFPQGGINEGENIETAM
YRELYEEVGLTKKDVRLLWASKYWLKYKLPKRLVRNDASQPVCIGQKQRW
FLLQLVSDESAVNLKTTKSPEFDGWRWVSFWYPVRQVVSFKRDVYRKVMR
EFAAILLNETRKGETERSVLEASDKREYQRRETRKSARAWNHYPKGK$

Gene Nucleotide Sequence:  Sequence Viewer
GTGATCGATTTCGATGGCTACCGCCCAAATGTAGGTATCGTCATTTGTAA
TAAGGTTGGGCAAGTTTTATGGGCGAGGCGGTTTGGACAAAACTCTTGGC
AATTTCCACAAGGTGGCATTAACGAGGGTGAAAACATTGAAACAGCAATG
TACCGTGAGCTTTATGAAGAAGTTGGCTTAACCAAAAAAGATGTACGATT
ATTATGGGCGTCTAAATATTGGCTGAAATATAAATTACCGAAGCGGTTAG
TGCGTAATGACGCAAGTCAGCCGGTATGTATTGGGCAAAAACAGCGTTGG
TTTTTATTGCAATTGGTTAGTGATGAAAGTGCAGTAAATTTAAAAACAAC
GAAAAGTCCAGAGTTTGATGGTTGGCGTTGGGTTAGCTTTTGGTATCCAG
TACGTCAGGTGGTGTCTTTTAAACGCGATGTTTATCGTAAAGTAATGCGC
GAGTTTGCCGCTATTTTATTGAATGAAACGAGAAAAGGCGAGACAGAAAG
AAGTGTGCTAGAAGCAAGCGATAAACGAGAATATCAACGGCGGGAAACAC
GTAAGTCGGCTAGAGCTTGGAATCATTATCCAAAAGGAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy