Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR114 IGR113 IGR108 IGR115 IGR112 IGR110 IGR107 IGR105 IGR106 IGR116 IGR111 IGR109 IGR104 HD0167 HD0175 HD0170 HD0168 HD0162 HD0171 HD0161 menG, - HD0166 ppa,ipyR, - HD0169 tfpB, - HD0163 invA,ygdP,nudH, - HD0172 gph, - HD0176 HD0173 lgt,umpA, - HD0174 trpS, - HD0177 mqo, - HD0165 HD0167 HD0175 HD0170 HD0168 HD0162 HD0171 HD0161 menG, - HD0166 ppa,ipyR, - HD0169 tfpB, - HD0163 invA,ygdP,nudH, - HD0172 gph, - HD0176 HD0173 lgt,umpA, - HD0174 trpS, - HD0177 mqo, - HD0165 Type: tandem, Name:  - 2 HD0175 HD0170 HD0168 HD0167 HD0161 menG, - HD0166 ppa,ipyR, - HD0169 tfpB, - HD0163 invA,ygdP,nudH, - HD0172 gph, - HD0176 HD0173 lgt,umpA, - HD0174 trpS, - HD0177 mqo, - HD0165 HD0164 HD0164 HD0162 HD0171
* Calculated from Protein Sequence

Gene ID: HD0169

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ppa  ipyR  

Definition:
inorganic pyrophosphatase, chain A

Gene Start:
114008

Gene Stop:
114535

Gene Length:
528

Molecular Weight*:
19409

pI*:
4.80

Net Charge*:
-7.08

EC:
3.6.1.1  

Functional Class:
Central intermediary metabolism; Phosphorus compounds  

Pathway: pathway table
Oxidative phosphorylation

Secondary Evidence:
Samygina VR, Popov AN, Rodina EV, Vorobyeva NN, Lamzin VS, Polyakov KM, Kurilova SA, Nazarova TI, Avaeva SM.
The structures of Escherichia coli inorganic pyrophosphatase complexed with Ca(2+) or CaPP(i) at atomic resolution and their mechanistic implications.
J Mol Biol. 2001 Nov 30;314(3):633-45.
PMID: 11846572

Hyytia T, Halonen P, Salminen A, Goldman A, Lahti R, Cooperman BS.
Ligand binding sites in Escherichia coli inorganic pyrophosphatase: effects of active site mutations.
Biochemistry. 2001 Apr 17;40(15):4645-53.
PMID: 11294631

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to Chain A, Structure Of Inorganic Pyrophosphatase protein e.g.; residues 1-129 are 83% similar to [2781227] Chain A, Structure Of Inorganic Pyrophosphatase of E.coli, residues 1-129 are 83% similar to [124870] inorganic pyrophosphatease (pyrophosphate phospho-hydrolase) of E.coli.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0221
COG name: Inorganic pyrophosphatase
Functional Class:  C
The phylogenetic pattern of COG0221 is --tkYq-ce-rhujgp--inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001596 (Inorganic pyrophosphatase) with a combined E-value of 4.7e-37.
    IPB001596A    43-96
    IPB001596B    132-143


ProDom Summary:  Protein Domain Search
Residues 9-99 are 42% similar to a (HYDROLASE INORGANIC PYROPHOSPHATASE) protein domain (PD095158) which is seen in Q9MAM9_ARATH.

Residues 18-101 are 92% similar to a (HYDROLASE INORGANIC PYROPHOSPHATASE) protein domain (PD403019) which is seen in IPYR_ECOLI.

Residues 103-169 are 89% similar to a (HYDROLASE INORGANIC PYROPHOSPHATASE) protein domain (PD002014) which is seen in IPYR_PASMU.



Paralogs:  Local Blast Search


HD0169 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 17 to 175 (E-value = 1.5e-66) place HD0169 in the Pyrophosphatase family which is described as Inorganic pyrophosphatase (PF00719)

PDB Hit:
pdb|1JFD|A Chain A, Structure Of Inorganic Pyrophosphatase >gi|... 305 2e-084
pdb|1MJZ| Structure Of Inorganic Pyrophosphatase Mutant D97n 303 9e-084
pdb|1MJX|A Chain A, Structure Of Inorganic Pyrophosphatase Muta... 303 9e-084

Gene Protein Sequence:
MGLENVPAGKALPDDIYVVIEIPANSDPIKYEVDKESGSLFVDRFMSTAM
FYPANYGYVNHTLSSDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDEA
GGDAKVVAVPHTKLTKEYDHIKDVNDLPALLKAQIQHFFESYKALEVGKW
VKVEGWGDVNEARQEILDSFERAKK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGCTTAGAAAACGTACCCGCTGGTAAAGCATTACCAGATGATATTTA
TGTAGTAATCGAAATTCCAGCAAATTCAGATCCGATTAAATATGAAGTAG
ATAAAGAGAGTGGTTCATTATTTGTTGATCGTTTTATGTCGACAGCCATG
TTTTATCCTGCAAACTATGGTTATGTAAACCATACTTTATCATCTGACGG
CGATCCAGTAGATGTGTTAGTGCCAACGCCATATCCATTACAACCGGGTT
CAGTGATTCGTTGCCGTCCGGTGGGTGTGTTAAAAATGACAGATGAAGCC
GGTGGTGATGCAAAAGTAGTGGCGGTTCCGCACACTAAATTAACTAAAGA
ATATGATCATATTAAAGATGTTAATGATTTACCAGCCTTATTAAAAGCAC
AAATTCAGCACTTCTTTGAAAGTTATAAAGCATTAGAAGTGGGTAAATGG
GTGAAAGTAGAAGGTTGGGGTGATGTGAATGAAGCGCGTCAAGAAATCTT
AGACTCATTTGAACGTGCTAAGAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy