Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR114 IGR113 IGR108 IGR115 IGR112 IGR102 IGR110 IGR103 IGR107 IGR105 IGR100 IGR106 IGR111 IGR109 IGR101 IGR104 HD0167 HD0160 HD0158 HD0170 HD0168 HD0162 HD0171 HD0157 HD0161 menG, - HD0166 ppa,ipyR, - HD0169 tfpB, - HD0163 invA,ygdP,nudH, - HD0172 HD0173 lgt,umpA, - HD0174 HD0156 HD0159 mqo, - HD0165 HD0167 HD0160 HD0158 HD0170 HD0168 HD0162 HD0171 HD0157 HD0161 menG, - HD0166 ppa,ipyR, - HD0169 tfpB, - HD0163 invA,ygdP,nudH, - HD0172 HD0173 lgt,umpA, - HD0174 HD0156 HD0159 mqo, - HD0165 Type: tandem, Name:  - 2 HD0160 HD0158 HD0170 HD0168 HD0167 HD0161 menG, - HD0166 ppa,ipyR, - HD0169 tfpB, - HD0163 invA,ygdP,nudH, - HD0172 HD0173 lgt,umpA, - HD0174 HD0156 HD0159 mqo, - HD0165 HD0164 HD0164 HD0162 HD0171 HD0157
* Calculated from Protein Sequence

Gene ID: HD0165

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
mqo  

Definition:
malate:quinone oxidoreductase

Gene Start:
111068

Gene Stop:
112537

Gene Length:
1470

Molecular Weight*:
54362

pI*:
7.80

Net Charge*:
4.11

EC:
1.1.99.16  

Functional Class:
Energy metabolism; TCA cycle  

Pathway: pathway table
Pyruvate metabolism

Secondary Evidence:
van der Rest ME, Frank C, Molenaar D.
Functions of the membrane-associated and cytoplasmic malate dehydrogenases in the citric acid cycle of Escherichia coli.
J Bacteriol. 2000 Dec;182(24):6892-9.
PMID: 11092847

Molenaar D, van der Rest ME, Drysch A, Yucel R.
Functions of the membrane-associated and cytoplasmic malate dehydrogenases in the citric acid cycle of Corynebacterium glutamicum.
J Bacteriol. 2000 Dec;182(24):6884-91.
PMID: 11092846

Kather B, Stingl K, van der Rest ME, Altendorf K, Molenaar D.
Another unusual type of citric acid cycle enzyme in Helicobacter pylori: the malate:quinone oxidoreductase.
J Bacteriol. 2000 Jun;182(11):3204-9.
PMID: 10809701

Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to malate:quinone oxidoreductasess. Residues 4-485 are 56% similar to this enzyme from Oceanobacillus iheyensis (23098401|) and residues 10-489 are 56% similar to
this enzyme from Bacillus halodurans (24638015|)

COGS Summary:  COGS Search
BeTs to 4 clades of COG0579
COG name: Predicted dehydrogenase
Functional Class: R
The phylogenetic pattern of COG0579 is a-----vcE-r-ujgp-----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 10-273 are 51% similar to a (OXIDOREDUCTASE MALATE:QUINONE PROTEOME) protein domain (PD247529) which is seen in MQO_ECOLI.

Residues 10-434 are 58% similar to a (OXIDOREDUCTASE MALATE:QUINONE FAD) protein domain (PD129963) which is seen in Q9Z9Q7_BACHD.

Residues 277-431 are 57% similar to a (OXIDOREDUCTASE MALATE:QUINONE PROTEOME) protein domain (PD272627) which is seen in Q9HYF4_PSEAE.



Paralogs:  Local Blast Search
HD0165 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 487 (E-value = 1e-278) place HD0165 in the Mqo family which is described as Malate:quinone oxidoreductase (Mqo) (PF06039)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNHSDSTSYSDITLIGAGIMSATLGTLLAELVPHKSITIFEQLAEVALES
SNEWNNAGTGHSALCELNYTEQNAQGEVKIERAMKICEDFQLSLQLWSYL
VEQGKIDKPQEFIHRIPHISFVQGEDNVAFLRKRYQQLSGHHLFSGMQFS
RDHAQLAKWMPLIMQNRSATEILAASYIENGTDVNFGSLTRKLCAYLTQQ
GKALKLMHRVKDIKQLANGDWQLTVLDQQQQQIIHRTKFVFIGCGGGSLP
LLQKSAIDAGKKIGGFPVSGLFMVCRNPELVAKHYAKVYGKAKLGAPPMS
VPHLDTRFIDGKQSLLFGPFASFTLKFLKQGSVFDLPKSIQASNFSSVMA
AGIKNLPLANYLIKQALLTKEQRMVELRDFIPDANSEDWQVLVAGKRVQV
LIDGEMRFGTEVVTAEDGSLAVLLGASPGASISVKAMLDVLLKCFSDELP
AWQHKLQHMLPSYQISLRDDAELYATLKRRFEASLLLDQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATCATTCAGACTCAACTAGCTATTCAGATATTACGTTGATTGGTGC
TGGTATTATGAGTGCAACCTTAGGTACACTTTTAGCGGAATTAGTCCCGC
ATAAAAGTATTACTATTTTTGAGCAATTAGCTGAGGTTGCATTAGAAAGT
TCAAACGAATGGAATAATGCCGGCACAGGACATTCAGCGTTGTGTGAATT
GAATTACACTGAGCAAAATGCACAAGGTGAAGTAAAGATCGAACGTGCAA
TGAAAATCTGTGAAGATTTTCAATTGTCTTTGCAGTTATGGAGTTATTTA
GTTGAGCAAGGCAAAATTGATAAACCACAAGAGTTTATTCATCGCATTCC
GCATATTAGCTTTGTGCAAGGTGAAGATAACGTAGCGTTTTTGCGAAAAC
GTTATCAGCAGTTATCAGGCCATCATCTTTTTTCGGGAATGCAATTCAGT
CGAGATCATGCTCAGTTAGCCAAATGGATGCCGTTGATTATGCAAAATAG
ATCCGCAACGGAAATCTTAGCGGCTAGTTATATTGAAAATGGAACGGATG
TCAATTTTGGCAGTTTAACACGCAAACTTTGCGCTTATTTAACCCAACAA
GGCAAAGCATTAAAGTTAATGCATAGGGTTAAAGATATCAAGCAGTTAGC
TAATGGTGATTGGCAATTAACCGTTTTAGATCAACAACAGCAACAGATTA
TTCATCGGACAAAATTTGTGTTTATTGGTTGTGGCGGTGGTAGCTTACCT
CTGTTACAGAAATCAGCAATTGATGCGGGCAAAAAAATCGGTGGTTTTCC
CGTCAGTGGGCTATTTATGGTGTGTCGTAATCCTGAACTAGTAGCAAAAC
ATTATGCTAAAGTGTATGGTAAGGCAAAATTAGGTGCGCCACCGATGTCT
GTTCCCCATTTAGACACGCGTTTTATTGATGGTAAGCAAAGTTTGTTATT
TGGTCCTTTTGCCAGTTTTACTTTAAAGTTTTTAAAACAGGGCAGTGTGT
TTGATTTGCCTAAATCAATTCAAGCATCGAATTTTTCTTCCGTGATGGCT
GCTGGAATTAAAAATTTGCCATTAGCCAATTATTTAATCAAACAGGCGTT
GTTAACTAAAGAACAGCGAATGGTCGAGTTACGTGATTTTATCCCCGACG
CTAACAGTGAAGATTGGCAAGTGCTGGTTGCGGGGAAAAGAGTACAAGTG
CTTATTGATGGTGAAATGCGATTTGGTACGGAGGTCGTTACTGCTGAAGA
TGGTTCATTAGCTGTATTGTTAGGGGCCTCCCCGGGGGCATCAATTTCAG
TGAAGGCTATGTTAGACGTATTGCTTAAATGTTTTTCAGATGAATTGCCC
GCTTGGCAACATAAATTACAACATATGTTGCCTTCATATCAGATTTCGTT
ACGTGATGATGCTGAATTATACGCCACCCTAAAACGCCGTTTTGAGGCAA
GTTTATTGTTAGATCAGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy