Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR114 IGR113 IGR108 IGR112 IGR102 IGR110 IGR99 IGR103 IGR107 IGR105 IGR100 IGR106 IGR111 IGR109 IGR101 IGR104 HD0167 HD0160 HD0158 HD0170 HD0168 HD0162 HD0171 HD0157 HD0161 menG, - HD0166 ppa,ipyR, - HD0169 tfpB, - HD0163 HD0155 invA,ygdP,nudH, - HD0172 HD0173 HD0156 HD0159 mqo, - HD0165 HD0167 HD0160 HD0158 HD0170 HD0168 HD0162 HD0171 HD0157 HD0161 menG, - HD0166 ppa,ipyR, - HD0169 tfpB, - HD0163 HD0155 invA,ygdP,nudH, - HD0172 HD0173 HD0156 HD0159 mqo, - HD0165 Type: tandem, Name:  - 2 HD0160 HD0158 HD0170 HD0168 HD0167 HD0157 HD0161 menG, - HD0166 ppa,ipyR, - HD0169 tfpB, - HD0163 HD0173 HD0156 HD0159 mqo, - HD0165 HD0164 HD0164 HD0162 HD0155 invA,ygdP,nudH, - HD0172 HD0171
* Calculated from Protein Sequence

Gene ID: HD0164

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
110628

Gene Stop:
110912

Gene Length:
285

Molecular Weight*:
11383

pI*:
7.50

Net Charge*:
0.85

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 15 to 90 are 54% ( EScore : 1e-19 ) identical to dbj|BAA94406.1| (AB041266) orf14 between residues 162 and 238 in [Actinobacillus actinomycetemcomitans]

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0164 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MYCYQHTFILYFLHLLSTYLYFVFFAFVIGYLKPCFKSQFDMLEVNDKMY
YVLAKYHKTFILSKELVDNGNFYLYELNPNELGHIQIVSINKSF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATTGTTATCAACATACCTTTATTTTGTATTTTTTGCATTTGTTATC
AACATACCTTTATTTTGTATTTTTTGCATTTGTTATCGGCTATCTTAAAC
CTTGCTTTAAAAGTCAATTCGATATGCTTGAAGTGAATGATAAAATGTAT
TATGTGTTGGCAAAATATCATAAAACGTTTATTTTATCTAAAGAATTGGT
TGATAATGGTAACTTCTACCTTTATGAGCTTAATCCAAATGAGTTAGGCC
ATATTCAAATAGTTAGCATTAATAAATCTTTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy