Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR98 IGR108 IGR102 IGR99 IGR103 IGR107 IGR105 IGR100 IGR106 IGR101 IGR104 HD0160 HD0158 HD0162 HD0152 HD0157 HD0161 menG, - HD0166 tfpB, - HD0163 HD0155 HD0156 HD0159 mqo, - HD0165 HD0154 HD0160 HD0158 HD0162 HD0152 HD0157 HD0161 menG, - HD0166 tfpB, - HD0163 HD0155 HD0156 HD0159 mqo, - HD0165 HD0154 Type: tandem, Name:  - 2 HD0160 HD0158 HD0157 HD0161 menG, - HD0166 tfpB, - HD0163 HD0155 HD0156 HD0159 mqo, - HD0165 HD0154 HD0164 HD0153 HD0152 HD0164 HD0162 HD0153
* Calculated from Protein Sequence

Gene ID: HD0159

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
107753

Gene Stop:
108613

Gene Length:
861

Molecular Weight*:
32592

pI*:
6.90

Net Charge*:
-0.49

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 136-278 are 51% similar to residues 2-144 of >19568172 AF316504_3 lactate dehydrogenase A2-like protein [Actinobacillus
actinomycetemcomitans].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0159 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLTIANGKNGDGHVAETNFWHSEYNQRGLVYLSRHSKALRLFLPTAHLGA
WLPDIETAKSVTLEPPARQGYPNNIDIVFEDGSDCPFSLCIDKAKQLDFT
PHFESTKIIIYLGSLNDYITLPCEIKLGNQQPQKTKEQYIYHVTVDTGHA
RKSPKSEVPSELIGQLKQWVKDMLDGQLRGIFDTKYTCRVGKHHSKLCEF
VISKTDDNFNHTDLVNFVVCRESRHNRQAWKLVGGQGNAPEVPFCAVKLH
NQNIQLDDMFNLSLFADFERCIAWAWLDLATNKEDK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTAACAATAGCAAACGGCAAAAACGGCGACGGACATGTCGCCGAAAC
TAACTTTTGGCACAGTGAGTACAATCAGCGCGGATTGGTTTATTTAAGCC
GACACAGTAAAGCCTTGCGCTTGTTTCTGCCGACCGCGCACTTGGGTGCG
TGGCTGCCGGATATTGAGACGGCTAAGTCGGTGACGCTTGAGCCACCGGC
GCGTCAAGGTTATCCAAACAATATTGATATTGTGTTTGAGGACGGCTCGG
ACTGCCCGTTTAGTCTGTGCATTGATAAAGCAAAACAGTTGGATTTTACA
CCGCATTTTGAATCAACAAAAATCATTATCTATCTTGGTTCGCTTAATGA
CTACATCACGCTGCCGTGCGAGATCAAACTTGGCAATCAGCAACCGCAAA
AAACAAAAGAGCAATATATTTATCACGTCACAGTTGACACGGGACATGCG
CGCAAAAGCCCCAAAAGTGAGGTGCCGTCGGAATTAATCGGACAACTCAA
ACAATGGGTAAAAGATATGCTAGACGGGCAACTGCGCGGGATTTTTGACA
CAAAATACACTTGTCGCGTGGGCAAACATCACAGCAAATTATGCGAGTTT
GTCATCAGCAAAACGGATGATAATTTTAATCATACTGATCTCGTTAATTT
CGTGGTATGCCGCGAGAGCCGGCACAATCGACAGGCATGGAAACTGGTAG
GCGGGCAAGGCAATGCACCCGAAGTCCCGTTCTGCGCGGTTAAACTACAT
AATCAAAATATACAATTAGACGATATGTTTAACTTGTCACTCTTCGCCGA
TTTTGAGCGTTGTATCGCTTGGGCGTGGTTAGATTTGGCGACAAATAAGG
AGGATAAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy