Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR97 IGR93 IGR96 IGR94 IGR98 IGR95 IGR102 IGR99 IGR103 IGR100 IGR101 IGR104 HD0160 HD0158 HD0152 HD0151 HD0157 HD0147 HD0161 HD0155 HD0150 HD0156 HD0159 HD0146 HD0148 HD0154 HD0160 HD0158 HD0152 HD0151 HD0157 HD0147 HD0161 HD0155 HD0150 HD0156 HD0159 HD0146 HD0148 HD0154 HD0160 HD0158 HD0157 HD0161 HD0155 HD0156 HD0159 HD0146 HD0148 HD0154 HD0149 HD0153 HD0152 HD0150 HD0147 HD0149 HD0151 HD0153
* Calculated from Protein Sequence

Gene ID: HD0154

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
103741

Gene Stop:
105390

Gene Length:
1650

Molecular Weight*:
61073

pI*:
7.00

Net Charge*:
0.00

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to hypothetical protein sequences from Xylella: residues 68-517 are 29% similar to hypothetical protein in Xylella fastidiosa strain 9a5c (11292989|).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 68-517 are 29% similar to a (PROTEOME COMPLETE XF0526 XF2115) protein domain (PD361375) which is seen in Q9PFY0_XYLFA.



Paralogs:  Local Blast Search

HD0154 is paralogously related to HD1580 (0.0) and HD0538 (0.0).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VTTVYSGLISCYNAYPKKHSYRVRRSDKGWHDGAVWYLEKAKIMLRNDNL
KIKGLTPEQEENVRAIHAMNPAHILVECATNKSWGGKKELSDLDLDSYKK
AADTLYEEGFGLCIRYNRQTSIKEFIQQIVDHIGAAQYDNVETGKQTIKL
IRRDYKPEDLPVFNYDNGILSVRDDDSGATDKQPNQVIVKYREPVSNRDD
QAIANNIASVRMHGVISKTVEYKGVPTFDLAARLARDLELVASGLTRLKI
VFDMRASELKPGDVVRVNLPDRDIVDVVFRVGKLENGNDGEIIATCIQDV
FGLPAANYSTQKGESLYIPPDYTANPIQQARLIEVPYHVLPLVLSDAERA
FVKPTDCFVWALGAQPTALSVGYDMLVDVGGGYTQTATGSFTPFVRLLEP
VSPYQTNIKIKLEGDYAAVAGALALIVDDEIIKIDAVDFKTGTMTVGRGC
ADTVPQAHKADAVAWCYLLAAGTDESKYTVNERLNVKLLTRTAQQTLDES
KAEVLTLTTQQRQARPFCVELGVPRPRRTSGQTDSALGRQHAPRRWRQL$


Gene Nucleotide Sequence:  Sequence Viewer
GTGACTACGGTTTATAGCGGGTTGATTAGTTGCTATAACGCATACCCAAA
AAAACACAGTTATCGCGTGCGGCGCAGTGATAAAGGCTGGCATGACGGCG
CGGTGTGGTATCTGGAAAAAGCGAAAATCATGCTGCGTAACGACAATCTA
AAAATTAAAGGGTTGACGCCGGAACAAGAAGAAAATGTGCGTGCAATCCA
CGCCATGAATCCCGCGCATATCTTAGTTGAGTGCGCCACAAATAAGAGTT
GGGGCGGTAAAAAAGAATTATCCGATTTAGATTTGGATAGTTACAAAAAA
GCGGCGGATACGTTGTATGAAGAGGGATTCGGCTTGTGTATCCGCTACAA
CCGTCAAACGTCGATTAAAGAGTTTATCCAGCAAATTGTAGATCATATCG
GCGCGGCACAATATGACAACGTAGAAACGGGCAAACAAACCATTAAGCTT
ATTCGACGCGATTACAAGCCCGAGGATTTACCGGTGTTTAATTACGACAA
CGGGATTTTATCGGTGCGTGATGATGACAGCGGCGCAACGGATAAGCAGC
CGAATCAAGTGATTGTTAAGTATCGTGAGCCGGTAAGCAATCGCGACGAC
CAAGCTATCGCCAATAATATCGCTTCCGTGCGCATGCACGGGGTGATAAG
CAAAACGGTGGAATACAAAGGCGTGCCGACGTTTGACTTAGCCGCGCGCC
TTGCGCGGGATTTGGAGCTTGTGGCAAGCGGATTGACGCGTCTTAAGATT
GTATTTGATATGCGCGCATCTGAACTTAAGCCCGGTGATGTTGTGCGCGT
CAATTTGCCCGACCGCGATATTGTTGACGTGGTGTTCCGCGTGGGCAAAC
TTGAAAACGGCAACGACGGCGAAATTATTGCAACTTGTATCCAAGATGTA
TTCGGCTTGCCCGCGGCTAATTACTCGACGCAAAAGGGCGAATCCCTTTA
CATTCCGCCCGATTATACCGCCAATCCGATTCAGCAGGCGCGCTTAATTG
AGGTGCCGTATCATGTGTTGCCGCTTGTGTTATCGGACGCAGAGCGCGCG
TTTGTTAAGCCGACGGATTGTTTTGTGTGGGCGTTGGGCGCGCAACCCAC
CGCGCTTTCGGTGGGCTACGACATGCTTGTTGATGTGGGCGGTGGCTATA
CGCAAACCGCCACGGGGTCATTTACGCCGTTTGTGCGATTGCTGGAGCCT
GTGAGCCCGTATCAAACAAACATTAAAATCAAGCTTGAGGGCGATTATGC
GGCGGTTGCGGGCGCGTTAGCACTCATTGTTGATGATGAGATTATCAAGA
TTGATGCCGTGGATTTTAAAACCGGCACAATGACCGTGGGGCGAGGTTGC
GCGGATACCGTTCCGCAAGCGCACAAAGCGGACGCGGTGGCGTGGTGTTA
CTTACTCGCCGCAGGGACGGACGAGAGCAAATATACGGTCAATGAGCGAC
TTAACGTTAAGTTACTCACTCGCACCGCGCAACAGACGCTTGATGAGAGC
AAAGCCGAGGTGTTGACATTAACAACTCAACAACGGCAAGCCCGTCCTTT
TTGTGTTGAGCTGGGCGTACCGCGACCGCGACGTACAAGCGGACAAACTG
ATTCCGCACTCGGACGACAGCACGCTCCTCGGCGATGGCGTCAGCTATGA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy