Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR92 IGR97 IGR93 IGR96 IGR94 IGR98 IGR95 IGR99 IGR100 IGR101 HD0158 HD0152 HD0151 HD0157 HD0147 HD0155 HD0150 HD0156 HD0159 HD0146 HD0145 HD0148 HD0154 HD0158 HD0152 HD0151 HD0157 HD0147 HD0155 HD0150 HD0156 HD0159 HD0146 HD0145 HD0148 HD0154 HD0158 HD0157 HD0147 HD0155 HD0156 HD0159 HD0146 HD0145 HD0148 HD0154 HD0149 HD0153 HD0152 HD0150 HD0149 HD0151 HD0153
* Calculated from Protein Sequence

Gene ID: HD0153

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
103287

Gene Stop:
103757

Gene Length:
471

Molecular Weight*:
17281

pI*:
10.40

Net Charge*:
7.42

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to hypothetical protein sequences of Xylella: residues 1-115 are 40% similar to hypothetical protein in Xylella fastidiosa strain 9a5c (11292991|).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-115 are 40% similar to a (PROTEOME COMPLETE XF0526 XF2115) protein domain (PD361375) which is seen in Q9PBM5_XYLFA.



Paralogs:  Local Blast Search

HD0153 is paralogously related to HD1580 (3e-50) and HD0538 (3e-50).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MGGKKGGPVTVGYRYYWDIHSGLGRGPVNEIVEIRVDDKTAYVGKPGEIT
QSQAIFINKPNLFGGDNTGGEGGIQGRMEILMGEPDQKPSQMLINLLKGI
LNPAYLSGAVFGGGKRIRSPRYFESDKFFFKRRYYSGRIRSERPDSGLSR
HCDYGL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGCGGTAAAAAAGGTGGACCGGTCACGGTTGGTTATCGCTACTACTG
GGATATTCATTCCGGACTTGGGCGCGGTCCTGTCAACGAGATCGTTGAAA
TCCGCGTGGACGATAAGACGGCATATGTCGGTAAGCCGGGCGAAATTACA
CAATCTCAAGCCATTTTTATTAATAAGCCTAATTTATTTGGCGGGGATAA
TACGGGCGGCGAAGGCGGAATCCAAGGGCGCATGGAAATCTTAATGGGCG
AGCCAGACCAAAAACCGAGCCAAATGCTGATTAATCTGCTAAAAGGCATT
TTAAACCCAGCCTATCTAAGCGGTGCGGTGTTTGGCGGTGGAAAACGCAT
TAGATCACCGAGATATTTTGAGAGCGATAAGTTTTTTTTCAAACGGCGAT
ATTATTCCGGGCGAATTAGATCAGAAAGACCAGATTCCGGGCTTTCGCGG
CATTGTGACTACGGTTTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy