Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR92 IGR97 IGR93 IGR91 IGR96 IGR94 IGR98 IGR95 IGR99 IGR100 IGR101 HD0158 HD0152 HD0151 HD0157 HD0147 HD0143 HD0155 HD0150 HD0156 HD0146 HD0145 HD0148 HD0154 HD0158 HD0152 HD0151 HD0157 HD0147 HD0143 HD0155 HD0150 HD0156 HD0146 HD0145 HD0148 HD0154 HD0158 HD0157 HD0147 HD0155 HD0156 HD0146 HD0145 HD0148 HD0154 HD0144 HD0149 HD0142 HD0153 HD0152 HD0143 HD0150 HD0149 HD0142 HD0151 HD0153 HD0144
* Calculated from Protein Sequence

Gene ID: HD0150

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
102196

Gene Stop:
102819

Gene Length:
624

Molecular Weight*:
22830

pI*:
8.50

Net Charge*:
3.52

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 79-196 are 31% similar to residues 149-269 of >17987626 hypothetical phage protein [Brucella melitensis].

Otherwise, one significant hit in gapped BLAST to AGR_C_1769p in Agrobacterium tumefaciens (15155974|).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0150 is paralogously related to HD1575 (9e-44), HD0533 (9e-44), HD1576 (2e-26) and HD0534 (2e-26).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VTIKMPSNNPVARLYRGIPPSQTVTLTIMRLNWMDSEIRIVWIGTIIEAK
RPEIQTTQLISAGLSETMESAGLRLTWGRNCPYTLYDTDCKVKPGNFAVA
GLSITAMDGVSITVDLPQNLPQGWFNAGFIEWLDDGVVETRAVTVHEHNK
LTLMGGTQKLSIGTVIKVYPGCDGRAQTCLKKFNNMLNFGGIPHMPTKSP
YDGSRVF$

Gene Nucleotide Sequence:  Sequence Viewer
GTGACAATCAAAATGCCAAGCAACAATCCCGTGGCGCGCTTATATCGCGG
GATTCCGCCAAGTCAAACAGTTACGCTTACAATCATGCGTCTAAACTGGA
TGGATAGCGAGATTCGGATTGTGTGGATTGGCACGATAATTGAGGCAAAA
CGCCCCGAAATCCAAACTACGCAACTGATTTCCGCGGGCTTGTCAGAAAC
CATGGAAAGCGCCGGATTGCGCTTAACATGGGGTCGCAACTGCCCTTATA
CACTCTATGACACGGATTGCAAAGTTAAGCCGGGTAACTTTGCCGTAGCA
GGATTATCTATCACTGCGATGGACGGTGTATCAATCACCGTGGATTTACC
GCAAAACTTACCGCAAGGCTGGTTTAATGCGGGATTTATCGAATGGCTGG
ATGACGGTGTGGTTGAGACCCGCGCGGTGACCGTGCATGAGCATAATAAA
TTAACGCTCATGGGCGGGACGCAAAAACTATCCATTGGCACCGTGATTAA
AGTCTATCCGGGGTGCGACGGGCGGGCGCAAACGTGCCTTAAAAAATTTA
ACAACATGCTTAATTTTGGGGGGATTCCGCATATGCCGACAAAATCCCCG
TATGACGGCTCAAGAGTATTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy