Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR92 IGR97 IGR93 IGR91 IGR96 IGR94 IGR98 IGR95 IGR90 IGR99 HD0152 HD0151 HD0147 HD0143 HD0155 HD0150 HD0156 HD0146 HD0145 HD0148 HD0154 HD0140 HD0152 HD0151 HD0147 HD0143 HD0155 HD0150 HD0156 HD0146 HD0145 HD0148 HD0154 HD0140 HD0147 HD0156 HD0146 HD0145 HD0148 HD0154 HD0140 HD0144 HD0141 HD0149 HD0142 HD0153 HD0141 HD0152 HD0143 HD0150 HD0155 HD0144 HD0149 HD0142 HD0151 HD0153
* Calculated from Protein Sequence

Gene ID: HD0148

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
100603

Gene Stop:
101973

Gene Length:
1371

Molecular Weight*:
50890

pI*:
7.70

Net Charge*:
2.10

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Only one significant hit in gapped BLAST to residues 68-454 of a hypothetical protein in Xylella fastidiosa (11346120|). See also gi 15837124.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 68-454 are 29% similar to a (PROTEOME COMPLETE XF0522) protein domain (PD322297) which is seen in Q9PFY4_XYLFA.



Paralogs:  Local Blast Search
HD0148 is paralogously related to HD1574 (1e-123), HD0532 (1e-123), HD1573 (9e-36) and HD0531 (9e-36).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LLSVSVVGGEGIELNGPTSGTFNALALKKWTIKVGMQGTPVIDCVVTFNF
LGKNPITLHITGSRSTDWAFAPDWGDNVTENLEFLTRVHQSVTGAEQRIA
RRLSPRRTFEFKVALSAVARQAFESALYGYGSRVWSLPIYTDATRLAESV
TAGKAEIHLDTTGRDFSVQGRALLVAGAQKEMVEITAIAPDKLTLKRAIV
SNFDRAFTLVYPLRAAVLTDMPIVTRLSDGAATAQVRLQISEHNGWQDDI
AHLPTYRNHPVLEPTSEWSEDITAQYMRLIKRLDNETGLPYYLDTANKAF
QLTNYRFVLSDRDMQRKLRNLFYYLRGRQRAIWVATSATDVTPVGDLLGK
TLDIAFINYTAALQKQTGRQDVRIECTDGRIFYRRIVSAAVVDSNTERLA
LDGETLHIKQSEILKISFLTLSRLDSDTISWVHHTDADGVATVSVSFRGL
RDELEI$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCTTTCCGTTTCCGTGGTTGGCGGTGAGGGGATTGAGTTAAACGGTCC
GACATCAGGGACATTTAACGCACTCGCGCTTAAAAAGTGGACGATTAAAG
TGGGTATGCAGGGCACGCCGGTGATTGATTGCGTCGTAACCTTTAATTTT
TTAGGTAAAAATCCCATTACGCTACATATTACCGGCTCCCGCTCCACTGA
TTGGGCGTTTGCGCCGGATTGGGGCGATAACGTCACCGAAAATCTGGAGT
TTTTGACCCGTGTACATCAATCGGTGACGGGCGCGGAGCAACGCATTGCG
CGCCGCTTATCCCCGCGCCGCACCTTTGAGTTTAAAGTGGCGTTAAGTGC
GGTGGCGCGTCAAGCTTTTGAAAGCGCGCTTTACGGCTACGGCTCGCGGG
TGTGGTCGCTGCCGATTTACACCGACGCTACGCGGCTTGCCGAATCTGTG
ACCGCAGGCAAGGCGGAAATCCATTTAGACACCACAGGGCGGGATTTTAG
CGTGCAAGGGCGCGCGCTGTTAGTTGCCGGTGCGCAAAAAGAAATGGTTG
AGATTACCGCTATTGCACCGGATAAACTCACACTTAAACGCGCCATCGTC
AGCAATTTTGACCGTGCTTTTACGCTTGTTTATCCGCTTCGCGCCGCGGT
GCTGACGGATATGCCGATTGTGACGAGATTGAGCGACGGCGCGGCGACGG
CACAAGTGCGGTTGCAAATTAGTGAGCATAACGGCTGGCAAGATGATATT
GCGCATTTGCCGACCTACCGCAACCATCCTGTGCTTGAACCGACCTCGGA
GTGGTCGGAAGACATCACCGCGCAATATATGCGATTAATCAAAAGGTTAG
ATAACGAGACGGGCTTGCCGTATTACTTAGACACCGCAAACAAGGCATTC
CAACTTACCAATTACCGCTTTGTTTTGTCCGACCGCGATATGCAACGCAA
GCTGCGTAATCTTTTTTACTACTTGCGCGGGCGTCAGCGTGCGATTTGGG
TTGCAACGTCCGCGACTGACGTGACGCCTGTGGGTGATTTACTGGGCAAA
ACGTTAGACATCGCGTTTATTAATTACACCGCGGCATTGCAAAAACAAAC
GGGACGGCAAGACGTGCGAATTGAATGCACCGACGGGCGGATTTTTTATC
GTCGCATTGTATCGGCAGCCGTAGTTGACAGTAACACCGAGCGCTTGGCA
TTAGATGGCGAGACGCTGCACATCAAGCAAAGCGAGATACTAAAAATCTC
CTTTTTGACGCTATCGCGGCTTGATAGCGACACCATAAGCTGGGTACATC
ACACCGACGCGGACGGGGTGGCAACAGTGAGCGTAAGTTTTCGCGGTTTG
CGCGACGAGCTTGAGATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy