Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR92 IGR93 IGR88 IGR91 IGR96 IGR94 IGR89 IGR95 IGR87 IGR90 HD0138 HD0151 HD0147 HD0143 HD0137 HD0150 HD0136 HD0146 HD0145 HD0148 HD0140 HD0138 HD0151 HD0147 HD0143 HD0137 HD0150 HD0136 HD0146 HD0145 HD0148 HD0140 Type: tandem, Name:  - 1 HD0147 HD0137 HD0136 HD0146 HD0145 HD0148 HD0140 HD0144 HD0141 HD0149 HD0142 HD0135 HD0141 HD0135 HD0143 HD0150 HD0138 HD0144 HD0149 HD0142 HD0151
* Calculated from Protein Sequence

Gene ID: HD0143

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:
0

Gene Name:


Definition:
bacteriophage TM4 gp14 protein homolog

Gene Start:
97812

Gene Stop:
98231

Gene Length:
420

Molecular Weight*:
14144

pI*:
8.40

Net Charge*:
1.41

EC:
 

Functional Class:
Other categories; Phage-related functions and prophages  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
A significant hit in gapped BLAST to gp17 protein sequences,e.g. residues 36-87 are 55% similar to gp17 in Mycobacteriophage TM4 (4336054|). Residues 43-91 are 61% similar to residues 1229-1270 of >17975176 gp15 [Bacteriophage phiE125].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0143 is paralogously related to HD1569 (1e-42) and HD0527 (1e-42).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LTIVNAMAQQLAMQASSAVGSWFGAAGSAAGAVTAATGGYISGPGTATSD
SIPAWLSNGEFVVRAASVSRYGLGFLHAINRGQLPRFATGGLVSAPAAPR
YREPGLSQHVGDERQAQAVASPVNIQPWLLIVPSCLPQD$

Gene Nucleotide Sequence:  Sequence Viewer
TTGACGATTGTCAATGCCATGGCCCAACAGCTTGCCATGCAAGCCTCTAG
CGCGGTGGGCAGTTGGTTCGGTGCGGCAGGGAGTGCGGCGGGTGCGGTGA
CGGCGGCGACAGGCGGCTATATCAGCGGACCGGGCACGGCGACATCGGAT
TCTATTCCGGCATGGTTATCTAACGGCGAGTTTGTGGTGCGGGCGGCGTC
GGTGTCGCGCTACGGTCTGGGATTTTTGCACGCCATTAACCGCGGGCAAC
TGCCAAGATTTGCCACAGGCGGTCTAGTTTCCGCGCCGGCTGCGCCGCGC
TATCGTGAGCCGGGATTAAGTCAACATGTGGGCGATGAGCGGCAAGCGCA
GGCAGTCGCCTCACCGGTCAATATCCAACCTTGGTTGTTGATAGTGCCGA
GTTGTTTACCGCAGGACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy