Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR83 IGR91 IGR88 IGR89 IGR87 IGR90 IGR86 IGR84 IGR85 HD0128 HD0138 HD0126 HD0133 HD0143 HD0134 HD0137 muG, - HD0127 muI, - HD0129 HD0136 HD0132 HD0145 HD0125 HD0140 HD0128 HD0138 HD0126 HD0133 HD0143 HD0134 HD0137 muG, - HD0127 muI, - HD0129 HD0136 HD0132 HD0145 HD0125 HD0140 Type: tandem, Name:  - 1 HD0128 HD0137 muI, - HD0129 HD0136 HD0132 HD0145 HD0125 HD0140 HD0144 HD0141 HD0142 muI, - HD0130 HD0135 HD0141 muI, - HD0130 HD0143 HD0134 HD0138 muG, - HD0127 HD0144 HD0142 HD0135 HD0133 HD0126
* Calculated from Protein Sequence

Gene ID: HD0136

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
93613

Gene Stop:
94353

Gene Length:
741

Molecular Weight*:
27141

pI*:
5.10

Net Charge*:
-5.26

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 5-244 are 29% similar to >17545582|ref|NP_518984.1| conserved hypothetical protein [Ralstonia solanacearum]. No other matches in gapped BLAST at this time.

COGS Summary:  COGS Search
BeTs to 3 clades of COG2217
COG name: Cation transport ATPases
Functional Class: P
The phylogenetic pattern of COG2217 is AmT-YQvCEBRhUJ---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0136 is paralogously related to HD1565 (4e-97) and HD0523 (4e-97).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MRNETYSYAQGKIFLAARLANGDIKDVRWVGDVSEASLSLSVEEFTHKES
YSGQRQEVRKIITGKSGELSLKFHEMSRENLALLLLGADSKVEAGTVTGE
KLPAEIKVGDRIVLAHQNVSNVTIAGLTENTDFMVDRTFGTIDFMKAQSG
DKEVAYSYGAVENVAMLTDNPQDLFLRYEGVNLAEQDEWVLMELYKINFN
PTDALALINNDNALAALTAKAKVLADTTKKGDDLLGRFGRVVKIKK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGAAATGAAACATATAGTTACGCTCAAGGAAAAATCTTTTTAGCCGC
GCGTTTAGCCAACGGTGATATTAAAGACGTGCGCTGGGTGGGGGATGTAT
CCGAAGCCAGTCTGTCGCTCAGCGTAGAGGAATTTACGCACAAAGAATCT
TACAGCGGTCAACGTCAAGAAGTGCGCAAAATTATTACCGGTAAATCGGG
CGAATTATCCCTTAAATTCCACGAAATGAGCCGTGAGAACTTGGCATTGT
TACTTTTGGGTGCAGACAGCAAAGTGGAAGCCGGCACGGTGACGGGCGAA
AAATTACCGGCAGAAATTAAAGTCGGTGATCGCATTGTGTTAGCACACCA
AAACGTGAGTAACGTCACGATTGCAGGCTTAACCGAAAATACCGATTTTA
TGGTTGACCGCACTTTTGGGACGATTGACTTTATGAAAGCGCAAAGCGGT
GACAAAGAAGTGGCATACAGCTATGGCGCGGTAGAAAACGTAGCAATGCT
CACCGACAATCCGCAGGATTTATTCTTGCGCTATGAGGGCGTCAACCTCG
CGGAGCAAGACGAATGGGTTTTAATGGAGCTTTACAAAATCAACTTTAAC
CCGACCGACGCGTTGGCATTAATCAACAATGACAATGCTTTGGCGGCGTT
AACGGCAAAAGCAAAAGTGCTTGCGGATACGACTAAAAAAGGCGATGACT
TGTTAGGTCGCTTCGGTCGCGTAGTCAAAATCAAAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy