Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR74 IGR72 IGR78 IGR73 IGR77 IGR69 IGR81 IGR68 IGR71 IGR79 IGR75 IGR80 IGR70 IGR76 HD0109 HD0119 HD0099 HD0100 HD0120 HD0101 HD0114 HD0096 HD0106 HD0115 HD0104 HD0118 HD0103 HD0110 HD0107 HD0112 HD0121 HD0097 HD0105 muB, - HD0095 muA,tpn, - HD0093 HD0109 HD0119 HD0099 HD0100 HD0120 HD0101 HD0114 HD0096 HD0106 HD0115 HD0104 HD0118 HD0103 HD0110 HD0107 HD0112 HD0121 HD0097 HD0105 muB, - HD0095 muA,tpn, - HD0093 HD0109 HD0119 HD0121 HD0097 HD0105 muB, - HD0095 muA,tpn, - HD0093 HD0102 HD0117 HD0098 HD0113 mor, - HD0111 HD0108 tpn, - HD0094 tpn, - HD0094 HD0100 HD0115 HD0103 HD0110 HD0107 HD0112 HD0096 HD0118 HD0098 mor, - HD0111 HD0108 HD0101 HD0114 HD0106 HD0104 HD0117 HD0120 HD0113 HD0099 HD0102
* Calculated from Protein Sequence

Gene ID: HD0105

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
79230

Gene Stop:
79967

Gene Length:
738

Molecular Weight*:
27878

pI*:
10.00

Net Charge*:
10.31

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 4-226 are 32% similar to >16760390 hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi]. Residues 58-226 are 39% similar to >24374204 conserved hypothetical protein [Shewanella oneidensis MR-1].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-226 are 27% similar to a (PROTEOME COMPLETE VC1196) protein domain (PD313459) which is seen in Q9KSR0_VIBCH.



Paralogs:  Local Blast Search
HD0105 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MQNEKTLRKIKKLLALSKSSNPHEAAKALEMAQKLMQENRINQVEIEFSQ
YHGKQKTAKKSARYVHQLVGVITRAFGVDAYMSNFYPDKDEAEEKMHVVF
YGAEGRPEIASYCFDVLYRQLQTARKEFLATQSKRLKRSTLISRGDEFCQ
GWVFGVHENVKEFAMTPEEKGKLERYRYNGFKDLQTAKVRDAGETRDYGL
ALSQGYKQGSKVTLNHGVNGKETTKLGGDEMKENNGWIACNLGSA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAAACGAGAAAACGCTTAGAAAAATCAAAAAGCTATTGGCGTTGAG
TAAGTCCTCAAACCCGCACGAAGCGGCGAAAGCGTTAGAGATGGCGCAAA
AATTAATGCAGGAAAATCGCATTAATCAAGTGGAAATTGAGTTTAGTCAG
TATCACGGCAAACAGAAAACCGCGAAGAAATCGGCGCGTTATGTGCATCA
GTTGGTTGGTGTAATTACACGGGCTTTTGGTGTAGATGCTTACATGTCTA
ATTTTTATCCGGACAAAGACGAGGCGGAAGAAAAAATGCACGTTGTGTTT
TATGGCGCGGAGGGACGCCCTGAAATTGCCTCTTACTGTTTTGACGTGTT
ATATCGCCAGTTACAAACCGCCCGCAAGGAGTTTTTAGCGACACAAAGCA
AGCGATTAAAACGCTCAACGCTAATTTCCCGTGGGGATGAATTTTGCCAA
GGTTGGGTGTTTGGCGTCCATGAAAACGTTAAAGAGTTTGCAATGACACC
GGAAGAAAAAGGCAAGTTGGAGCGATACCGATATAACGGTTTTAAAGACC
TACAGACCGCGAAAGTGCGCGATGCAGGCGAAACAAGAGACTACGGATTG
GCATTAAGTCAAGGCTATAAACAAGGGTCGAAAGTTACGTTAAATCATGG
GGTGAATGGGAAAGAAACGACTAAATTGGGGGGTGATGAGATGAAAGAGA
ATAATGGTTGGATTGCATGTAATTTAGGGAGTGCGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy