Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR74 IGR72 IGR73 IGR69 IGR67 IGR68 IGR71 IGR75 IGR70 IGR76 IGR66 IGR65 HD0109 HD0089 HD0099 HD0087 HD0100 HD0101 HD0096 nlp, - HD0090 HD0106 HD0104 HD0103 HD0107 HD0110 HD0112 HD0097 HD0105 muB, - HD0095 muA,tpn, - HD0093 HD0109 HD0089 HD0099 HD0087 HD0100 HD0101 HD0096 nlp, - HD0090 HD0106 HD0104 HD0103 HD0107 HD0110 HD0112 HD0097 HD0105 muB, - HD0095 muA,tpn, - HD0093 HD0109 HD0089 HD0087 nlp, - HD0090 HD0097 HD0105 muB, - HD0095 muA,tpn, - HD0093 HD0102 HD0098 mor, - HD0111 HD0108 tpn, - HD0094 tpn, - HD0094 HD0100 HD0103 HD0107 HD0112 HD0096 HD0098 HD0101 HD0106 HD0104 HD0110 mor, - HD0111 HD0108 HD0099 HD0102
* Calculated from Protein Sequence

Gene ID: HD0097

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
76929

Gene Stop:
77546

Gene Length:
618

Molecular Weight*:
23098

pI*:
5.60

Net Charge*:
-1.79

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1 to 205 are 53% ( EScore : 9e-58 ) identical to emb|CAB71969.1| (AJ391256) hypothetical protein [Neisseria meningitidis] >7380508|emb|CAB85094.1| between residues 1 and 203 in [Neisseria meningitidis]

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-205 are 53% similar to a (PROTEOME COMPLETE NMA1871) protein domain (PD310533) which is seen in Q9JRE4_NEIME.



Paralogs:  Local Blast Search
HD0097 is paralogously related to HD0489 (1e-61).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MENQEIPQGYRRNAKGALIPEASIKAIDKERDELVNDIVRKAEIVQEILK
GFKNEVFGDISAFVELSAEQYGAQIGGKKGNVTVYSFDGKYRVQRAISEH
LQFDERIMAAKALIEECLQDWTAGSRAELKAIIDRAFDVDKEGNLNTNKI
LALRRVNISDSRWVRAMDAISDSVQVVGSKSYIRIYKRVGDTDRYEPISL
DLANV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAACCAAGAAATTCCGCAAGGCTACCGCCGAAATGCAAAAGGTGC
GCTTATCCCCGAGGCGTCAATTAAAGCCATCGACAAAGAGCGCGATGAGT
TAGTCAACGACATTGTACGCAAAGCCGAAATCGTGCAAGAAATCTTAAAA
GGCTTTAAGAACGAAGTGTTTGGCGATATTTCCGCGTTTGTTGAGCTTTC
CGCCGAGCAATACGGCGCGCAAATTGGGGGTAAAAAAGGCAATGTGACAG
TTTACAGCTTTGATGGCAAATACCGTGTACAACGCGCCATTAGCGAGCAT
TTGCAATTTGATGAACGGATTATGGCAGCAAAAGCCTTAATCGAAGAATG
CTTGCAAGACTGGACGGCTGGCAGTCGCGCCGAGCTAAAAGCGATTATCG
ACCGCGCCTTTGATGTTGACAAAGAGGGCAACCTCAACACCAACAAAATT
TTAGCCTTGCGCCGTGTAAATATCAGTGATTCGCGTTGGGTGCGCGCCAT
GGACGCGATTTCTGACAGCGTGCAAGTGGTTGGCTCCAAGTCTTATATCC
GCATTTATAAGCGCGTGGGCGACACCGACCGTTACGAGCCGATCTCGTTG
GACTTGGCGAATGTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy