Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR67 IGR64 IGR60 IGR68 IGR63 IGR61 IGR59 IGR66 IGR65 IGR62 HD0085 HD0089 HD0087 HD0083 HD0096 nlp, - HD0090 napC,nirT,nrfH, - HD0079 muB, - HD0095 rpoH, - HD0086 murB, - HD0081 lctD, - HD0084 muA,tpn, - HD0093 HD0085 HD0089 HD0087 HD0083 HD0096 nlp, - HD0090 napC,nirT,nrfH, - HD0079 muB, - HD0095 rpoH, - HD0086 murB, - HD0081 lctD, - HD0084 muA,tpn, - HD0093 HD0085 HD0089 HD0087 nlp, - HD0090 napC,nirT,nrfH, - HD0079 muB, - HD0095 rpoH, - HD0086 murB, - HD0081 lctD, - HD0084 muA,tpn, - HD0093 tpn, - HD0094 birA, - HD0082 tpn, - HD0094 birA, - HD0082 HD0083 HD0096
* Calculated from Protein Sequence

Gene ID: HD0086

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
rpoH  

Definition:
RNA polymerase sigma-32 factor

Gene Start:
71206

Gene Stop:
72165

Gene Length:
960

Molecular Weight*:
36731

pI*:
4.70

Net Charge*:
-19.79

EC:
2.7.7.6  

Functional Class:
Regulatory functions  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism
RNA polymerase

Secondary Evidence:
Calendar,R., Erickson,J.W., Halling,C. and Nolte,A.
Deletion and insertion mutations in the rpoH gene of Escherichia
coli that produce functional sigma 32
J. Bacteriol. 170 (8), 3479-3484 (1988)
MEDLINE: 88298653

Landick,R., Vaughn,V., Lau,E.T., VanBogelen,R.A., Erickson,J.W. and Neidhardt,F.C.
Nucleotide sequence of the heat shock regulatory gene of E. coli
suggests its protein product may be a transcription factor
Cell 38 (1), 175-182 (1984)
MEDLINE: 84282700

Yura,T., Tobe,T., Ito,K. and Osawa,T.
Heat shock regulatory gene (htpR) of Escherichia coli is required
for growth at high temperature but is dispensable at low
temperature
Proc. Natl. Acad. Sci. U.S.A. 81 (21), 6803-6807 (1984)
MEDLINE: 85038603

Solis-Guzman G, Ramirez-Santos J, Souza V, Gomez-Eichelmann MC.
Analysis of the regulatory region of the heat-shock gene rpoH of Escherichia coli strains isolated from non-human hosts.
FEMS Microbiol Lett. 2001 Dec 18;205(2):191-6.
PMID: 11750801

Aramaki H, Hirata T, Hara C, Fujita M, Sagara Y.
Transcription analysis of rpoH in Pseudomonas putida.
FEMS Microbiol Lett. 2001 Dec 18;205(2):165-9.
PMID: 11750797


Comment:
For other "rpo" genes, see HD1172 (rpoE), HD1876 (rpoC), HD1877 (rpoB), HD1923 (rpoZ), HD1951 (rpoA), HD0691 (rpoD), HD0692 (rpoD).

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to RP32 sequences, for example residues 46-315 are 72% similar to residues 10-279 of RP32_HAEIN (1173123) and 66% similar to RP32_ECOLI (133287).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0568
COG name: DNA-dependent RNA polymerase sigma subunits (sigma70/32)
Functional Class: K
The phylogenetic pattern of COG0568 is -----QvCEBRHujgpOLinX
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB000943 (Sigma-70 factor family) with a combined E-value of 9.5e-28.
    IPB000943    101-152


ProDom Summary:  Protein Domain Search
Residues 236-312 are 53% similar to a (FACTOR RNA POLYMERASE SIGMA REGULATION DNA-BINDING) protein domain (PD340420) which is seen in RP32_PROMI.

Residues 267-312 are 69% similar to a (FACTOR POLYMERASE RNA SIGMA REGULATION DNA-BINDING) protein domain (PD004281) which is seen in O82849_PSEHY.

Residues 163-229 are 67% similar to a (FACTOR POLYMERASE RNA SIGMA) protein domain (PD003643) which is seen in RP32_HAEIN.

Residues 267-315 are 73% similar to a (FACTOR RNA POLYMERASE SIGMA) protein domain (PD228014) which is seen in RP32_HAEIN.

Residues 84-128 are 88% similar to a (FACTOR POLYMERASE RNA SIGMA) protein domain (PD000245) which is seen in RP32_HAEIN.



Paralogs:  Local Blast Search
HD0086 is paralogously related to HD0691 (8e-19).


Pfam Summary:  Pfam Search
Residues 88 to 158 (E-value = 5.7e-22) place HD0086 in the Sigma70_r2 family which is described as Sigma-70 region 2 (PF04542)
Residues 262 to 313 (E-value = 6.4e-14) place HD0086 in the Sigma70_r4 family which is described as Sigma-70, region 4 (PF04545)

PDB Hit:
pdb|1SIG| Crystal Structure Of A Sigma70 Subunit Fragment Fr... 64 2e-011

Gene Protein Sequence:
MKKFDEYEIEDAEILEADADDQDILEESELQHKIMHPALVQGSLPVQQGN
LDSYIRMANQYPILTAEQEKTLAERYYYDEDVDAAKQLILSHMRFVIHIA
RGYMGYGLPLADLIQEGNIGLMKAVKRFDPNVGVRLVSFAVHWVKAEIHE
YVLKNWRIVKVATTKAQRKLFFNLRKNKHRLAWFNEDEIQQVAQDLGVST
EEVREMESRMTGQDVGFDISANEDESEVYVPSMYLEDNSSNFADELEEEQ
HTGEATAKLAYALATLDERSQDIIKTRWLDENKATLHELAAKYSISAERV
RQLENAALKKIKDTITLEQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAATTTGATGAATATGAGATTGAGGACGCTGAAATTCTTGAAGC
TGATGCTGATGATCAGGATATTTTAGAAGAGTCTGAACTGCAACATAAAA
TAATGCACCCCGCGTTAGTTCAAGGTAGTTTACCTGTTCAGCAAGGTAAT
TTAGATAGTTATATTCGAATGGCCAACCAATACCCGATTTTAACCGCGGA
ACAAGAGAAAACGTTGGCAGAGCGTTATTATTATGATGAAGATGTTGATG
CAGCAAAGCAACTTATTTTGTCGCATATGCGTTTTGTGATTCATATTGCT
CGTGGGTATATGGGCTATGGTTTGCCGTTAGCCGATTTAATTCAAGAGGG
TAATATCGGCTTGATGAAAGCAGTAAAACGTTTTGATCCAAACGTGGGTG
TTCGTTTGGTTTCTTTTGCGGTGCATTGGGTTAAAGCAGAGATTCACGAA
TATGTATTAAAAAATTGGCGGATTGTGAAAGTGGCTACCACGAAGGCACA
ACGTAAACTATTTTTTAATTTACGCAAAAATAAACATCGTTTAGCTTGGT
TTAATGAAGATGAAATTCAGCAAGTCGCACAAGATTTAGGTGTTTCAACT
GAAGAAGTGCGTGAAATGGAATCGCGTATGACAGGGCAAGATGTTGGCTT
TGATATTTCTGCAAATGAAGATGAAAGTGAAGTTTATGTGCCGTCTATGT
ATTTAGAAGATAATAGCTCAAATTTTGCTGATGAATTGGAAGAAGAACAG
CATACCGGTGAGGCAACGGCTAAATTAGCCTATGCGTTAGCTACATTAGA
TGAACGCAGTCAAGATATTATTAAAACACGCTGGTTAGATGAAAATAAAG
CCACATTACACGAATTAGCTGCTAAATATAGTATTTCAGCTGAGCGTGTT
CGTCAGCTTGAAAATGCGGCACTGAAAAAAATTAAAGACACGATTACTTT
GGAACAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy