Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR58 IGR67 IGR64 IGR60 IGR63 IGR57 IGR61 IGR59 IGR66 IGR65 IGR62 HD0085 HD0089 HD0087 HD0083 nlp, - HD0090 napB, - HD0078 napC,nirT,nrfH, - HD0079 napH, - HD0077 napG, - HD0076 rpoH, - HD0086 murB, - HD0081 lctD, - HD0084 muA,tpn, - HD0093 HD0085 HD0089 HD0087 HD0083 nlp, - HD0090 napB, - HD0078 napC,nirT,nrfH, - HD0079 napH, - HD0077 napG, - HD0076 rpoH, - HD0086 murB, - HD0081 lctD, - HD0084 muA,tpn, - HD0093 HD0085 HD0089 HD0087 nlp, - HD0090 napB, - HD0078 napC,nirT,nrfH, - HD0079 napH, - HD0077 napG, - HD0076 rpoH, - HD0086 murB, - HD0081 lctD, - HD0084 muA,tpn, - HD0093 tpn, - HD0094 birA, - HD0082 tpn, - HD0094 birA, - HD0082 HD0083
* Calculated from Protein Sequence

Gene ID: HD0084

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lctD  

Definition:
l-lactate dehydrogenase, lctD

Gene Start:
69428

Gene Stop:
70573

Gene Length:
1146

Molecular Weight*:
41720

pI*:
8.60

Net Charge*:
3.37

EC:
1.1.1.27  1.1.2.3  

Functional Class:
Energy metabolism; Anaerobic respiration  

Pathway: pathway table
Cysteine metabolism
Glycolysis / Gluconeogenesis
Propanoate metabolism
Pyruvate metabolism

Secondary Evidence:
Dong,J.M., Taylor,J.S., Latour,D.J., Iuchi,S. and Lin,E.C.
Three overlapping lct genes involved in L-lactate utilization by
Escherichia coli
J. Bacteriol. 175 (20), 6671-6678 (1993)
Medline: 94012541


Comment:


Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to LLDD sequences, e.g. residues 1-376 are 75% similar to LLDD_ECOLI (462488). Residues 1-381 are 83% similar to LLDD_HAEIN (1170799).

COGS Summary:  COGS Search
BeTs to 7 clades of COG1304
COG name: L-lactate dehydrogenase (FMN-dependent) and related alpha-hydroxy acid dehydrogenases
Functional Class: C
The phylogenetic pattern of COG1304 is Amtky--cebRh----ol--x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000262 (FMN-dependent alpha-hydroxy acid dehydrogenases) with a combined E-value of 7.9e-147.
    IPB000262A    17-65
    IPB000262B    66-113
    IPB000262C    125-170
    IPB000262D    229-257
    IPB000262E    258-294
    IPB000262F    299-351
***** IPB001295 (Dihydroorotate dehydrogenase) with a combined E-value of 9.6e-06.
    IPB001295F    258-276
    IPB001295H    301-331


ProDom Summary:  Protein Domain Search
Residues 13-376 are 84% similar to a (DEHYDROGENASE OXIDASE OXIDOREDUCTASE BIOSYNTHESIS FMN) protein domain (PD000662) which is seen in LLDD_HAEIN.



Paralogs:  Local Blast Search
HD0084 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 13 to 377 (E-value = 1.3e-211) place HD0084 in the FMN_dh family which is described as FMN-dependent dehydrogenase (PF01070)

PDB Hit:
pdb|1AL7| Three-Dimensional Structures Of Glycolate Oxidase ... 210 2e-055
pdb|1GOX| Glycolate Oxidase (E.C.1.1.3.1) 210 2e-055
pdb|1GYL|A Chain A, Glycolate Oxidase (E.C.1.1.3.15) Mutant Wit... 208 7e-055

Gene Protein Sequence:
MIIASANDYREAARRRVPPFMFHYADGGSFSERTLARNVSDLADLALRQR
VLKDMSQLNTEIELFGEKLAMPIVLAPVGALGMYARRGEVQAAQAAENKG
LPFTLSTVSVCPIEEVTPAIKRPMWYQLYVLKDRGFMKSVLERAKAAGCS
TLVFTVDMPTPGARYRDLHSGMSGKYKEIRRVLQAMTHPRWAWDVGINGK
PHTLGNVSGYTGKSVGLDDYAVWLADNFDPSISWKDLEWIRDFWDGPMVI
KGILDVEDAKDAVRFGADGIVVSNHGGRQLDGALSSAKALPSIADAVKGE
IKILADSGIRNGLDVVRMIALGADATLIGRAFVYALSAAGRAGVENMLDI
FRKEMHVAMTLTSNARISDINRDALVDLTKI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTATTGCATCAGCAAATGACTATCGTGAAGCGGCTCGCCGTCGTGT
TCCCCCGTTTATGTTCCACTATGCAGATGGTGGTTCATTTTCCGAACGTA
CTTTAGCGCGTAATGTAAGTGATTTAGCCGATCTTGCACTTCGCCAACGA
GTATTAAAAGATATGTCGCAATTGAACACGGAAATTGAATTGTTTGGCGA
AAAGCTCGCAATGCCAATTGTTTTAGCGCCTGTTGGTGCGTTAGGAATGT
ATGCTCGTCGCGGAGAAGTACAAGCTGCACAAGCCGCTGAAAATAAAGGC
TTGCCGTTTACATTATCGACAGTTTCAGTTTGTCCTATTGAAGAAGTTAC
TCCAGCAATTAAAAGACCAATGTGGTATCAACTCTATGTGTTGAAAGATC
GTGGTTTTATGAAAAGTGTGTTAGAACGGGCAAAAGCAGCAGGTTGTTCA
ACATTAGTATTTACTGTGGATATGCCAACCCCGGGAGCACGTTATCGTGA
TTTGCATTCGGGTATGAGCGGTAAGTACAAAGAAATTCGCCGAGTGCTAC
AAGCTATGACACATCCTCGTTGGGCGTGGGACGTTGGTATAAATGGTAAG
CCACATACATTAGGTAATGTTTCAGGCTATACCGGTAAATCGGTCGGTTT
AGATGATTATGCGGTATGGTTAGCGGATAATTTTGATCCATCCATTTCAT
GGAAAGATTTAGAGTGGATCCGTGATTTCTGGGACGGCCCGATGGTGATT
AAAGGCATTTTAGATGTTGAAGATGCGAAAGATGCGGTTCGTTTTGGTGC
GGATGGGATTGTCGTATCTAACCACGGTGGACGCCAACTAGATGGTGCAT
TATCGAGTGCTAAAGCATTACCTTCCATTGCTGATGCAGTGAAAGGCGAG
ATCAAAATTCTAGCTGACTCAGGTATTCGAAATGGTCTAGATGTCGTGCG
TATGATCGCATTAGGCGCTGATGCTACACTGATTGGCCGTGCATTTGTTT
ATGCATTATCAGCAGCTGGACGCGCAGGTGTAGAAAATATGTTAGATATT
TTCAGAAAAGAAATGCACGTTGCAATGACGTTAACAAGTAATGCGAGAAT
TAGTGATATTAATCGTGATGCATTAGTTGATCTGACTAAAATATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy