Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR58 IGR67 IGR64 IGR60 IGR63 IGR57 IGR61 IGR56 IGR59 IGR66 IGR65 IGR62 HD0085 HD0089 HD0087 HD0083 nlp, - HD0090 napB, - HD0078 napC,nirT,nrfH, - HD0079 napH, - HD0077 napG, - HD0076 rpoH, - HD0086 murB, - HD0081 lctD, - HD0084 muA,tpn, - HD0093 napA, - HD0074 HD0085 HD0089 HD0087 HD0083 nlp, - HD0090 napB, - HD0078 napC,nirT,nrfH, - HD0079 napH, - HD0077 napG, - HD0076 rpoH, - HD0086 murB, - HD0081 lctD, - HD0084 muA,tpn, - HD0093 napA, - HD0074 HD0085 HD0089 HD0087 napB, - HD0078 napC,nirT,nrfH, - HD0079 napH, - HD0077 napG, - HD0076 rpoH, - HD0086 murB, - HD0081 lctD, - HD0084 muA,tpn, - HD0093 napA, - HD0074 birA, - HD0082 birA, - HD0082 HD0083 nlp, - HD0090
* Calculated from Protein Sequence

Gene ID: HD0082

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
birA  

Definition:
biotin operon repressor / biotin acetyl coenzyme A carboxylase synthetase (birA)

Gene Start:
68355

Gene Stop:
69191

Gene Length:
837

Molecular Weight*:
31208

pI*:
7.90

Net Charge*:
2.97

EC:
6.3.4.15  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Biotin  
Regulatory functions  

Pathway: pathway table
Biotin metabolism

Secondary Evidence:
Howard,P.K., Shaw,J. and Otsuka,A.J.
Nucleotide sequence of the birA gene encoding the biotin operon
repressor and biotin holoenzyme synthetase functions of Escherichia coli
Gene 35 (3), 321-331 (1985)
Medline: 86006282

Buoncristiani,M.R., Howard,P.K. and Otsuka,A.J.
DNA-binding and enzymatic domains of the bifunctional biotin operon repressor (BirA) of Escherichia coli
Gene 44 (2-3), 255-261 (1986)
Medline: 87055242


Wilson,K.P., Shewchuk,L.M., Brennan,R.G., Otsuka,A.J. and
Matthews,B.W.
Escherichia coli biotin holoenzyme synthetase/bio repressor crystal structure delineates the biotin- and DNA-binding domains
Proc. Natl. Acad. Sci. U.S.A. 89 (19), 9257-9261 (1992)
Medline: 93028443


Comment:
This protein acts as a Biotin Operon Repressor And a Biotin Holoenzyme synthetase.

For other biotin-related genes, see HD0634, HD0635, HD1007, HD1394, HD1480, HD1680, HD1681.

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to BirA bifunctional proteins. Residues 28-276 are 42% similar to BIRA_ECOLI (115015). Residues 28-278 are 35% similar to BIRA_HAEIN (1168673).

COGS Summary:  COGS Search
BeTs to 15 clades of COG0340
COG name: Biotin-(acetyl-CoA carboxylase) ligase
Functional Class: H
The phylogenetic pattern of COG0340 is amtkyqvcebrhuj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003142 (Biotin protein ligase C terminal domain) with a combined E-value of 4.5e-18.
    IPB003142A    73-89
    IPB003142B    133-142


ProDom Summary:  Protein Domain Search
Residues 44-276 are 42% similar to a (LIGASE BIOTIN PROTEOME COMPLETE) protein domain (PD004125) which is seen in BIRA_ECOLI.



Paralogs:  Local Blast Search
HD0082 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 44 to 176 (E-value = 1e-30) place HD0082 in the BPL_LipA_LipB family which is described as Biotin/lipoate A/B protein ligase family (PF03099)

PDB Hit:
pdb|1BIA| Bira Bifunctional Protein (Acts As Biotin Operon Re... 208 5e-055

Gene Protein Sequence:
MLSSILKFVLSGKQVKSIVKKLHVNMKLNTSQIQNALWCGEAIVFDEIDS
TNAYLLSHYQSLEQGSICLAEQQTAGRGRRGRNWYSPASQNLYFSMLWHY
SSTEATDLPALSLVVALIIAETLQAQQVEHIQIKWPNDIYYQGKKMGGIL
IESKVDRNGIHLVVGVGLNLAMKQVDETIVTQAWADLSHYQFDRNALVCQ
LAVALQKNLKIYPLVGFSHYLERWQTFDIFCDQSVKLVAGNNQIHGISRG
INQHGELLLEQNGVTTAFGIGEMSLRLK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGAGCTCCATCCTGAAGTTCGTTTTATCGGGCAAACAGGTGAAGTC
GATAGTGAAGAAATTACACGTTAATATGAAACTGAATACCTCCCAGATCC
AAAATGCTTTATGGTGCGGTGAAGCGATTGTTTTTGATGAAATTGATTCA
ACTAATGCATATTTATTAAGCCATTATCAATCTCTTGAACAAGGCTCAAT
CTGTTTAGCAGAACAGCAAACAGCAGGCCGTGGTAGGCGTGGCAGAAATT
GGTACTCGCCTGCAAGTCAGAATCTTTATTTTTCAATGCTATGGCATTAT
TCAAGCACAGAAGCGACAGATTTACCCGCATTAAGTCTAGTTGTGGCATT
GATTATTGCCGAAACGTTGCAAGCACAACAGGTCGAACATATTCAAATTA
AATGGCCGAATGATATTTATTATCAAGGTAAAAAAATGGGCGGGATTTTG
ATTGAAAGTAAAGTAGATCGGAATGGCATTCATTTGGTTGTTGGTGTGGG
CTTAAATTTAGCTATGAAACAGGTTGATGAAACTATAGTCACTCAAGCTT
GGGCGGATTTATCGCACTATCAATTTGACCGTAATGCGTTAGTTTGTCAG
TTAGCGGTAGCTTTACAAAAAAATCTTAAAATTTATCCGCTTGTTGGCTT
TAGCCATTATCTTGAGCGTTGGCAAACATTTGATATTTTTTGTGATCAAT
CCGTCAAACTCGTGGCTGGAAATAACCAAATTCACGGCATTTCGCGCGGT
ATTAATCAACACGGTGAATTGTTATTAGAGCAAAATGGTGTTACAACGGC
TTTTGGTATTGGTGAAATGTCACTTCGTCTTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy