Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR58 IGR64 IGR60 IGR63 IGR57 IGR61 IGR56 IGR59 IGR65 IGR62 HD0085 HD0089 HD0087 HD0083 napB, - HD0078 napC,nirT,nrfH, - HD0079 napH, - HD0077 napG, - HD0076 rpoH, - HD0086 murB, - HD0081 lctD, - HD0084 napA, - HD0074 HD0085 HD0089 HD0087 HD0083 napB, - HD0078 napC,nirT,nrfH, - HD0079 napH, - HD0077 napG, - HD0076 rpoH, - HD0086 murB, - HD0081 lctD, - HD0084 napA, - HD0074 HD0085 HD0089 HD0087 napB, - HD0078 napC,nirT,nrfH, - HD0079 napH, - HD0077 napG, - HD0076 rpoH, - HD0086 murB, - HD0081 lctD, - HD0084 napA, - HD0074 birA, - HD0082 birA, - HD0082 HD0083
* Calculated from Protein Sequence

Gene ID: HD0081

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
murB  

Definition:
UDP-n-acetylenolpyruvoylglucosamine reductase

Gene Start:
67394

Gene Stop:
68428

Gene Length:
1035

Molecular Weight*:
38476

pI*:
6.40

Net Charge*:
-4.10

EC:
1.1.1.158  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Aminosugars metabolism

Secondary Evidence:
Pucci,M.J., Discotto,L.F. and Dougherty,T.J.
Cloning and identification of the Escherichia coli murB DNA
sequence, which encodes UDP-N-acetylenolpyruvoylglucosamine
reductase
J. Bacteriol. 174 (5), 1690-1693 (1992)

Benson,T.E., Marquardt,J.L., Marquardt,A.C., Etzkorn,F.A. and
Walsh,C.T.
Overexpression, purification, and mechanistic study of
UDP-N-acetylenolpyruvylglucosamine reductase
Biochemistry 32 (8), 2024-2030 (1993)
M:93192262

Benson,T.E., Walsh,C.T. and Hogle,J.M.
The structure of the substrate-free form of MurB, an essential
enzyme for the synthesis of bacterial cell walls
Structure 4 (1), 47-54 (1996)
M:96419135

Benson,T.E., Walsh,C.T. and Hogle,J.M.
X-ray crystal structures of the S229A mutant and wild-type MurB in
the presence of the substrate enolpyruvyl-UDP-N-acetylglucosamine
at 1.8-A resolution
Biochemistry 36 (4), 806-811 (1997)
M:97172910


Comment:
For other "mur" genes, see HD1906 (murI), HD0242 (murE), HD0243 (murF), HD0245 (murD), HD0253 (murA), HD0823 (murC), HD0824 (murG).

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to MurB proteins, e.g. residues 6-341 are 62% similar to MURB_PASMU (13431699). Residues 6-342 are 61% similar to MURB_HAEIN (1171070).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0812
COG name: UDP-N-acetylmuramate dehydrogenase
Functional Class: M
The phylogenetic pattern of COG0812 is -----Qvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003170 (UDP-N-acetylenolpyruvoylglucosamine reductase) with a combined E-value of 1.4e-77.
    IPB003170A    47-56
    IPB003170B    83-133
    IPB003170C    146-166
    IPB003170D    227-236
    IPB003170E    268-322


ProDom Summary:  Protein Domain Search
Residues 6-87 are 54% similar to a (CELL REDUCTASE) protein domain (PD023163) which is seen in MURB_PASMU.

Residues 183-261 are 46% similar to a (PROTEOME COMPLETE) protein domain (PD391102) which is seen in Q9KV40_VIBCH.

Residues 88-188 are 64% similar to a (CELL FAD NADP ALL) protein domain (PD394187) which is seen in MURB_HAEIN.

Residues 88-335 are 64% similar to a (CELL REDUCTASE) protein domain (PD004983) which is seen in MURB_PASMU.



Paralogs:  Local Blast Search

HD0081 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 205 to 332 (E-value = 4.5e-56) place HD0081 in the MurB_C family which is described as UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain (PF02873)

PDB Hit:
pdb|1MBB| Oxidoreductase >gi|1827629|pdb|1MBT| Oxidoreductase 402 4e-113
pdb|2MBR| Murb Wild Type, Complex With Enolpyruvyl-Udp-N-Ace... 397 9e-112
pdb|1UXY| Murb Mutant With Ser 229 Replaced By Ala, Complex ... 396 2e-111

Gene Protein Sequence:
MIMNHSLLPFHTFHLPACANQIIEFTTVSQLITEWQKATRADQAVLILGQ
GSNVLFLDDFNGVVLVNKLKGIQHREDHDYHYIQAQGGENWHNLVEWTLA
KNIAGLENLALIPGVVGSAPIQNIGAYGVEFEQFCDFVEVVNLANGQIFR
LDKQACQFGYRDSVFKHQYRHSFAIISVGLKLAKAWTPTLNYGSLVKFSA
DTVTSQQIFDEVCAIRSSKLPDPDEYGNAGSFFKNPIIDATTFAEIQTAF
PQIPYYPQPDGNIKLAAGWLIDQCELKGFQIGGAAVHTQQALVLINKAHA
TGRQVVELAQQVRRRVRHKFNVELHPEVRFIGQTGEVDSEEITR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTATGAACCATAGTTTACTTCCATTCCATACTTTTCATTTACCCGC
ATGTGCTAATCAGATCATTGAATTTACTACAGTGTCACAATTAATCACCG
AATGGCAAAAAGCAACTAGGGCAGATCAAGCGGTATTAATTTTAGGGCAA
GGATCAAATGTTTTATTTCTAGATGATTTTAACGGTGTGGTATTAGTTAA
TAAATTGAAAGGTATTCAACATCGAGAAGATCACGACTATCATTATATTC
AAGCACAAGGCGGTGAAAATTGGCATAATTTGGTCGAATGGACGTTGGCT
AAGAATATTGCGGGTTTAGAAAATTTAGCCTTGATTCCTGGCGTAGTGGG
TTCAGCGCCCATTCAAAATATTGGCGCCTATGGTGTTGAATTTGAGCAAT
TTTGTGATTTTGTTGAAGTGGTTAATTTAGCAAATGGTCAAATTTTTCGT
TTAGATAAACAAGCGTGTCAATTTGGTTACCGGGACAGTGTGTTTAAGCA
TCAATATCGCCATTCATTTGCGATTATTTCGGTTGGCTTGAAATTAGCTA
AGGCCTGGACGCCAACTTTAAATTATGGTTCATTAGTCAAATTTTCGGCT
GATACGGTTACGTCACAACAAATATTTGATGAAGTCTGTGCTATTCGATC
GAGTAAGTTACCTGATCCTGATGAATACGGTAATGCCGGTAGTTTTTTTA
AAAATCCGATAATTGACGCTACAACATTTGCTGAAATTCAGACCGCTTTC
CCGCAGATCCCCTATTATCCACAGCCCGACGGCAACATTAAATTGGCCGC
TGGTTGGCTGATTGATCAATGTGAGTTAAAAGGTTTTCAGATTGGTGGTG
CCGCTGTTCATACTCAACAAGCATTAGTGTTAATCAATAAAGCTCATGCA
ACGGGTAGACAAGTTGTTGAGCTTGCTCAACAAGTTCGTCGTCGTGTTCG
GCATAAATTTAATGTTGAGCTCCATCCTGAAGTTCGTTTTATCGGGCAAA
CAGGTGAAGTCGATAGTGAAGAAATTACACGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy